Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637676

    Description: epitope description:TVKDKIAKEQENKETIGTLK antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  2. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637681

    Description: epitope description:NKISEASRKGLRRDLDASRE antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  3. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637692

    Description: epitope description:AKKQVEKALEEANSLKAALE antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  4. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637703

    Description: epitope description:TRQELANKQQESKENEKALN antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  5. Mapping of epitopes for autoantibodies to the type 1 diabetes autoantigen IA-2 by peptide phage display and molecular modeling: overlap of antibody an...

    ID: 1637714

    Description: epitope description:NPEDCFKTGCNSPT host organism:Homo sapiens antibody name:96/3

    Publication: 15034020;

  6. Epitope map of two polyclonal antibodies that recognize amyloid lesions in patients with Alzheimer's disease.

    ID: 1641683

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1372166;

  7. Development and characterization of monoclonal antibodies specific for amylin.

    ID: 1641884

    Description: epitope description:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF antigen name:Calcitonin gene-related peptide 2 host organism:Mus musculus BALB/c antibody na...

    Publication: 8913788;

  8. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641888

    Description: epitope description:NACQFQRLNAQRPDN antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  9. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641889

    Description: epitope description:QFQRLNAQRPDNRIE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  10. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641892

    Description: epitope description:PDNRIESEGGYIETW antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  11. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641896

    Description: epitope description:ETWNPNNQEFECAGV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  12. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641897

    Description: epitope description:NPNNQEFECAGVALS antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  13. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641898

    Description: epitope description:NQEFECAGVALSRLV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  14. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641901

    Description: epitope description:ALSRLVLRRNALRRP antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  15. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641903

    Description: epitope description:LRRNALRRPFYSNAP antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  16. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641904

    Description: epitope description:NALRRPFYSNAPQEI antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  17. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641907

    Description: epitope description:NAPQEIFIQQGRGYF antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  18. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641917

    Description: epitope description:QQGRRHQSQRPPRRF antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  19. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641922

    Description: epitope description:QGQDQSQQQQDSHQK antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  20. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641928

    Description: epitope description:FDEGDLIAVPTGVAF antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  21. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641930

    Description: epitope description:IAVPTGVAFWMYNDH antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  22. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641939

    Description: epitope description:NNNDNQLDQFPRRFN antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  23. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641941

    Description: epitope description:LDQFPRRFNLAGNHE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  24. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641955

    Description: epitope description:QEDREFSPRGQHGRR antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  25. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641956

    Description: epitope description:REFSPRGQHGRRERA antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  26. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641957

    Description: epitope description:SPRGQHGRRERAGQE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  27. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641958

    Description: epitope description:GQHGRRERAGQEQEN antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  28. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641965

    Description: epitope description:SGFTPEFLAQAFQVD antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  29. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641972

    Description: epitope description:NLRGENESDEQGAIV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  30. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641975

    Description: epitope description:EQGAIVTVRGGLRIL antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  31. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641977

    Description: epitope description:TVRGGLRILSPDRKR antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  32. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641985

    Description: epitope description:EEEYDEDEYEYDEEE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  33. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641990

    Description: epitope description:RQQDRRRGRGSRGSG antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  34. Single chain variable fragments against beta-amyloid (Abeta) can inhibit Abeta aggregation and prevent abeta-induced neurotoxicity.

    ID: 1641304

    Description: epitope description:GAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Homo sapiens antibody name:C1

    Publication: 15170333;

  35. Zinc binding agonist effect on the recognition of the beta-amyloid (4-10) epitope by anti-beta-amyloid antibodies.

    ID: 1641307

    Description: epitope description:DAEFRHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:Bam-10

    Publication: 15358179;

  36. Immune hyporesponsiveness to amyloid beta-peptide in amyloid precursor protein transgenic mice: implications for the pathogenesis and treatment of Alz...

    ID: 1641309

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 11517335;

  37. Species-specific immune response to immunization with human versus rodent A beta peptide.

    ID: 1641321

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 15312960;

  38. Surface exposed epitopes and structural heterogeneity of in vivo formed transthyretin amyloid fibrils.

    ID: 1641348

    Description: epitope description:WEPFASGKTS antigen name:Transthyretin host organism:Oryctolagus cuniculus

    Publication: 16893521;

  39. Surface exposed epitopes and structural heterogeneity of in vivo formed transthyretin amyloid fibrils.

    ID: 1641351

    Description: epitope description:WEPFASGKTS antigen name:Transthyretin host organism:Oryctolagus cuniculus

    Publication: 16893521;

  40. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641365

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:8G7

    Publication: 16908985;

  41. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641373

    Description: epitope description:DAEFRHDSGYEVHHQKL antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 16908985;

  42. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641379

    Description: epitope description:AIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:22C4

    Publication: 16908985;

  43. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641380

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:8G7

    Publication: 16908985;

  44. Immunogenicity of CIGB-230, a therapeutic DNA vaccine preparation, in HCV-chronically infected individuals in a Phase I clinical trial.

    ID: 1641444

    Description: epitope description:TGTYVTGGTAARGVSQFTGLFTSGPSQKIQL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 19017255;

  45. Amino acid and phenotypic changes in dengue 2 virus associated with escape from neutralisation by IgM antibody.

    ID: 1641455

    Description: epitope description:T69 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 11536239;

  46. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641456

    Description: epitope description:VRGRGSK host organism:Homo sapiens

    Publication: 15569135;

  47. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641465

    Description: epitope description:NIKSSLP host organism:Homo sapiens

    Publication: 15569135;

  48. Thermodynamic studies on the interaction of antibodies with beta-amyloid peptide.

    ID: 1641470

    Description: epitope description:RHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:B41-N

    Publication: 17266280;

  49. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641476

    Description: epitope description:STGERIQ host organism:Homo sapiens

    Publication: 15569135;

  50. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641479

    Description: epitope description:LDQSRLK host organism:Homo sapiens

    Publication: 15569135;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston