Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes in beta-lactoglobulin by alanine scanning analysi...

    ID: 1960364

    Description: epitope description:KALPMHIRLSFNPTQ antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 22939793;

  2. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960400

    Description: epitope description:QLYQTCKAAGTCPSDVIPKI antigen name:Minor capsid protein L2 host organism:Mus musculus C57BL/6

    Publication: 22761884;

  3. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960404

    Description: epitope description:QLYQTCKAAGTCPSDVIPKI antigen name:Minor capsid protein L2 host organism:Mus musculus C57BL/6

    Publication: 22761884;

  4. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960409

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c

    Publication: 22761884;

  5. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960413

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c

    Publication: 22761884;

  6. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969557

    Description: epitope description:DMFTQRQVAEFKEGF antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 22192087;

  7. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969569

    Description: epitope description:TDQELDEMLADAPAP antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 22192087;

  8. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969578

    Description: epitope description:KYVVRYMYDIDNNGF antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 22192087;

  9. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969582

    Description: epitope description:DAYANNQKIMRNLWN antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 22192087;

  10. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969583

    Description: epitope description:ANNQKIMRNLWNEIA antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 22192087;

  11. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969586

    Description: epitope description:MADAAVIEKLEAGFK antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 22192087;

  12. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969588

    Description: epitope description:ISTRVRCGRSLQGYP antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 22192087;

  13. Is epitope recognition of shrimp allergens useful to predict clinical reactivity?

    ID: 1969598

    Description: epitope description:DLGQVFRRLTSAVNE antigen name:Lit v 2 host organism:Homo sapiens

    Publication: 22192087;

  14. Molecular basis of antibody mediated immunity against Ehrlichia chaffeensis involves species-specific linear epitopes in tandem repeat proteins.

    ID: 1969612

    Description: epitope description:SDLHGSFSVELFDPFKEAVQLGNDLQQSSD antigen name:Variable length PCR target protein host organism:Mus musculus

    Publication: 22658957;

  15. Molecular basis of antibody mediated immunity against Ehrlichia chaffeensis involves species-specific linear epitopes in tandem repeat proteins.

    ID: 1969619

    Description: epitope description:SDLHGSFSVELFDPFKEAVQLGNDLQQSSD antigen name:Variable length PCR target protein host organism:Mus musculus C57BL/6

    Publication: 22658957;

  16. Molecular basis of antibody mediated immunity against Ehrlichia chaffeensis involves species-specific linear epitopes in tandem repeat proteins.

    ID: 1969698

    Description: epitope description:SKVEQEETNPEVLIKDLQDVAS antigen name:120 kDa immunodominant surface protein host organism:Mus musculus

    Publication: 22658957;

  17. Molecular basis of antibody mediated immunity against Ehrlichia chaffeensis involves species-specific linear epitopes in tandem repeat proteins.

    ID: 1969700

    Description: epitope description:ASVSEGDAVVNAVSQETPA antigen name:Other Ehrlichia chaffeensis protein host organism:Oryctolagus cuniculus

    Publication: 22658957;

  18. Molecular basis of antibody mediated immunity against Ehrlichia chaffeensis involves species-specific linear epitopes in tandem repeat proteins.

    ID: 1969701

    Description: epitope description:SKVEQEETNPEVLIKDLQDVAS antigen name:120 kDa immunodominant surface protein host organism:Oryctolagus cuniculus

    Publication: 22658957;

  19. Molecular basis of antibody mediated immunity against Ehrlichia chaffeensis involves species-specific linear epitopes in tandem repeat proteins.

    ID: 1969704

    Description: epitope description:SKVEQEETNPEVLIKDLQDVAS antigen name:120 kDa immunodominant surface protein host organism:Mus musculus

    Publication: 22658957;

  20. Outer domain of HIV-1 gp120: antigenic optimization, structural malleability, and crystal structure with antibody VRC-PG04.

    ID: 1969717

    Description: epitope description:K248, V250, S252, E271, S274, D275, N276, A277, K278, S358, G359, G360, D361, I364, R447, D448, G449, G450, S456, R463, G466, G467...

    Publication: 23236069;

  21. A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

    ID: 1969723

    Description: epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:...

    Publication: 23217740;

  22. Outer domain of HIV-1 gp120: antigenic optimization, structural malleability, and crystal structure with antibody VRC-PG04.

    ID: 1969724

    Description: epitope description:K248, V250, S252, E271, S274, D275, N276, A277, K278, S358, G359, G360, D361, I364, R447, D448, G449, G450, S456, R463, G466, G467...

    Publication: 23236069;

  23. Camelid heavy-chain variable domains provide efficient combining sites to haptens.

    ID: 1969731

    Description: epitope description:Reactive Red 6 hapten copper complex host organism:Lama glama antibody name:R2

    Publication: 10684599;

  24. Camelid heavy-chain variable domains provide efficient combining sites to haptens.

    ID: 1969733

    Description: epitope description:Reactive Red 6 hapten copper complex host organism:Lama glama antibody name:R2

    Publication: 10684599;

  25. Camelid heavy-chain variable domains provide efficient combining sites to haptens.

    ID: 1969734

    Description: epitope description:Reactive Red 6 hapten copper complex host organism:Lama glama antibody name:R2

    Publication: 10684599;

  26. Identification of immunodominant peptides from Gnathostoma binucleatum.

    ID: 1969759

    Description: epitope description:FTINLHSK antigen name:Gnathostoma binucleatum protein host organism:Homo sapiens

    Publication: 22949520;

  27. Identification of immunodominant peptides from Gnathostoma binucleatum.

    ID: 1969760

    Description: epitope description:IEPGQTLIVK antigen name:Gnathostoma binucleatum protein host organism:Homo sapiens

    Publication: 22949520;

  28. Identification of three novel linear B-cell epitopes on the VP5 protein of BTV16.

    ID: 1969798

    Description: epitope description:ITANTREIQHIKEE antigen name:Outer capsid protein VP5 host organism:Mus musculus BALB/c antibody name:3B11

    Publication: 23290575;

  29. Identification of three novel linear B-cell epitopes on the VP5 protein of BTV16.

    ID: 1969799

    Description: epitope description:ITANTREIQHIKEE antigen name:Outer capsid protein VP5 host organism:Mus musculus BALB/c antibody name:3G9

    Publication: 23290575;

  30. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969806

    Description: epitope description:MDRADTLEQQNKEAN antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  31. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969810

    Description: epitope description:EANNRAEKSEEEVHN antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  32. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969811

    Description: epitope description:NRAEKSEEEVHNLQK antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  33. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969812

    Description: epitope description:EKSEEEVHNLQKRMQ antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  34. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969814

    Description: epitope description:VHNLQKRMQQLENDL antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  35. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969818

    Description: epitope description:NDLDQVQESLLKANI antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  36. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969819

    Description: epitope description:DQVQESLLKANIQLV antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  37. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969820

    Description: epitope description:QESLLKANIQLVEKD antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  38. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969822

    Description: epitope description:ANIQLVEKDKALSNA antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  39. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969824

    Description: epitope description:EKDKALSNAEGEVAA antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  40. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969827

    Description: epitope description:EGEVAALNRRIQLLE antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  41. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969833

    Description: epitope description:ERSEERLNTATTKLA antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  42. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969840

    Description: epitope description:DESERMRKVLENRSL antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  43. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969845

    Description: epitope description:SDEERMDALENQLKE antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  44. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969848

    Description: epitope description:ENQLKEARFLAEEAD antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  45. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969851

    Description: epitope description:LAEEADRKYDEVARK antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  46. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969855

    Description: epitope description:ARKLAMVEADLERAE antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  47. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969861

    Description: epitope description:ETGESKIVELEEELR antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  48. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969866

    Description: epitope description:VVGNNLKSLEVSEEK antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  49. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969872

    Description: epitope description:REEAYKEQIKTLTNK antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  50. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969878

    Description: epitope description:AEARAEFAERSVQKL antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  51. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969879

    Description: epitope description:RAEFAERSVQKLQKE antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  52. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969897

    Description: epitope description:GGSNVFDMFTQRQVA antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  53. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969902

    Description: epitope description:EFKEGFQLMDRDKDG antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  54. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969904

    Description: epitope description:QLMDRDKDGVIGKTD antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  55. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969907

    Description: epitope description:VIGKTDLRGTFDEIG antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  56. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969917

    Description: epitope description:PAPINFTMLLNMFAE antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  57. Greater epitope recognition of shrimp allergens by children than by adults suggests that shrimp sensitization decreases with age.

    ID: 1969919

    Description: epitope description:TMLLNMFAERQTGES antigen name:Other Litopenaeus vannamei (white shrimp) protein host organism:Homo sapiens

    Publication: 20471069;

  58. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950879

    Description: epitope description:RDLKLNQNMDLHIEE antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  59. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950882

    Description: epitope description:RDMTYSAPITVDIEY antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;

  60. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950884

    Description: epitope description:RDPNPPKRPLIFDTN antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  61. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950886

    Description: epitope description:RDQFIATLREMIARD antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  62. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950887

    Description: epitope description:RDQLKESLQETKARD antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  63. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950891

    Description: epitope description:RDWGQNEAADAMSRL antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  64. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950895

    Description: epitope description:REHLLDQLKRKQPEL antigen name:Kinesin-like protein KIF11 host organism:Homo sapiens

    Publication: 21621003;

  65. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950899

    Description: epitope description:REKEDQIKKLQEYID antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  66. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950902

    Description: epitope description:REKFAWAIDMADEDY antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 21621003;

  67. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950903

    Description: epitope description:REKMAQELKYGDIVE antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  68. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950904

    Description: epitope description:REKMAQELKYGDIVE antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  69. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950909

    Description: epitope description:REMIARDRQNHQVKP antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  70. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950924

    Description: epitope description:RETLAKIQESQSKQE antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  71. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950926

    Description: epitope description:REVKCPFPSRPDNGF antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 21621003;

  72. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950933

    Description: epitope description:RFLLKNLRPNRQLAN antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 21621003;

  73. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950938

    Description: epitope description:RFWWENEGVFSMQQR antigen name:Myeloperoxidase host organism:Homo sapiens

    Publication: 21621003;

  74. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950948

    Description: epitope description:RGGVSLAALKKALAA antigen name:Histone H1.1 host organism:Homo sapiens

    Publication: 21621003;

  75. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950951

    Description: epitope description:RGNLSGKRVDFSGRT antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  76. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950953

    Description: epitope description:RGPRAVLTRQPTEGR antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;

  77. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950956

    Description: epitope description:RGPSLGASSHQHSRR antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 21621003;

  78. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950958

    Description: epitope description:RGRGRGGGGGGGGGG antigen name:rRNA 2'-O-methyltransferase fibrillarin host organism:Homo sapiens

    Publication: 21621003;

  79. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950968

    Description: epitope description:RHYGETKMNQRSSRS antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  80. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950971

    Description: epitope description:RIANFKIEPPGLFRG antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 21621003;

  81. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950972

    Description: epitope description:RIANFKIEPPGLFRG antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 21621003;

  82. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950993

    Description: epitope description:RIPYACKLLFQELQS antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;

  83. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1950999

    Description: epitope description:RISGLIYEETRGVLK antigen name:Histone H4 host organism:Homo sapiens

    Publication: 21621003;

  84. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951005

    Description: epitope description:RKAIADWYNEKGGMA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 21621003;

  85. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951012

    Description: epitope description:RKASGPPVSELITKA antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 21621003;

  86. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951013

    Description: epitope description:RKEEKVRASGDAKIK antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 21621003;

  87. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951014

    Description: epitope description:RKEEKVRASGDAKIK antigen name:DNA topoisomerase 1 host organism:Homo sapiens

    Publication: 21621003;

  88. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951016

    Description: epitope description:RKEIMDLKKQLEEVS antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  89. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951019

    Description: epitope description:RKGRVGPLLACIIGT antigen name:Myeloperoxidase host organism:Homo sapiens

    Publication: 21621003;

  90. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951021

    Description: epitope description:RKLVQNGPEVHPGAN antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  91. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951027

    Description: epitope description:RKYGVASTCRKTNKL antigen name:Major centromere autoantigen B host organism:Homo sapiens

    Publication: 21621003;

  92. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951028

    Description: epitope description:RKYGVASTCRKTNKL antigen name:Major centromere autoantigen B host organism:Homo sapiens

    Publication: 21621003;

  93. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951029

    Description: epitope description:RKYLPTYRSYNDSVD antigen name:Myeloperoxidase host organism:Homo sapiens

    Publication: 21621003;

  94. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951035

    Description: epitope description:RLAREICVKFTRGVD antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 21621003;

  95. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951036

    Description: epitope description:RLAREICVKFTRGVD antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 21621003;

  96. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951037

    Description: epitope description:RLARHGGVKRILGLI antigen name:Histone H4-like protein type G host organism:Homo sapiens

    Publication: 21621003;

  97. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951039

    Description: epitope description:RLARRGGVKRISGLI antigen name:Histone H4 host organism:Homo sapiens

    Publication: 21621003;

  98. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951050

    Description: epitope description:RLELAQKLNENYEEV antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;

  99. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951054

    Description: epitope description:RLEVNAETVRYSICT antigen name:DNA-directed RNA polymerase III subunit RPC1 host organism:Homo sapiens

    Publication: 21621003;

  100. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1951062

    Description: epitope description:RLNEMEQLKEQLENR antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston