Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "
  1. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952241

    Description: epitope description:VTSRATQLTTEKIRE antigen name:Centromere-associated protein E host organism:Homo sapiens

    Publication: 21621003;
  2. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952248

    Description: epitope description:VTWEVLEGEVEKEAL antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 21621003;
  3. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952385

    Description: epitope description:YLNIYVGLPDVEESF antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;
  4. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952392

    Description: epitope description:YMASLQMRGNPGSHF antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21621003;
  5. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952402

    Description: epitope description:YPNVFLVFLNGNILG antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;
  6. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952405

    Description: epitope description:YQCAMGKQAMGTIGY antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;
  7. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952410

    Description: epitope description:YQKLKHMVLDKMHAR antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;
  8. Computational analysis of high-density peptide microarray data with application from systemic sclerosis to multiple sclerosis.

    ID: 1952420

    Description: epitope description:YSAPITVDIEYTRGS antigen name:DNA-directed RNA polymerase III subunit RPC2 host organism:Homo sapiens

    Publication: 21621003;
  9. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015765

    Description: epitope description:PGPPPGGPG antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  10. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015766

    Description: epitope description:GPGSKLPWL antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  11. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015768

    Description: epitope description:GLVVLAVIA antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  12. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015769

    Description: epitope description:GLVVLAVIA antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  13. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015770

    Description: epitope description:VIALVATLV antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  14. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015773

    Description: epitope description:TLVVMKGGH antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  15. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015775

    Description: epitope description:GGHGSKPSG antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  16. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015777

    Description: epitope description:PSGATPSST antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  17. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015782

    Description: epitope description:SAQNATDCT antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  18. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015785

    Description: epitope description:DCTPNVSGG antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  19. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015789

    Description: epitope description:RSDSIAAGK antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  20. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015794

    Description: epitope description:SGWTVFSDD antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  21. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015796

    Description: epitope description:SDDQGPNLI antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  22. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015801

    Description: epitope description:GVAQDVPGA antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  23. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015803

    Description: epitope description:PGANQWMMT antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  24. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015804

    Description: epitope description:MMTAEVGVT antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  25. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015806

    Description: epitope description:GVTNFVPSM antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  26. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015810

    Description: epitope description:AQATKLMQC antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  27. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015813

    Description: epitope description:MQCLANGPG antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  28. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015814

    Description: epitope description:GPGYANAMP antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  29. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015815

    Description: epitope description:GPGYANAMP antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  30. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015823

    Description: epitope description:KAVRADADV antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  31. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015827

    Description: epitope description:DPTRNVKGD antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  32. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015828

    Description: epitope description:KGDSVTIIA antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  33. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015831

    Description: epitope description:IIAVDTKPV antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  34. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015835

    Description: epitope description:IGSTPIGDS antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  35. Antigenic epitopes of MAP2694 homologous to T-cell receptor gamma-chain are highly recognized in multiple sclerosis Sardinian patients.

    ID: 2015841

    Description: epitope description:IAALKVAKS antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 24091296;
  36. Heightened immune response to autocitrullinated Porphyromonas gingivalis peptidylarginine deiminase: a potential mechanism for breaching immunologic t...

    ID: 2015844

    Description: epitope description:QMQADRTNGQFATEEMQRAFQET + CITR(R6, R18) antigen name:Probable peptidylarginine deiminase host organism:Homo sapiens

    Publication: 23463691;
  37. An antibody that prevents the hemagglutinin low pH fusogenic transition.

    ID: 2015845

    Description: epitope description:A: S152, N153, W169, G174, S175, S202, T203, Q205, E206, T208, S209, G241, L242; C: T142, T144, P178, V179, N181 antigen name:Hema...

    Publication: 11886266;
  38. An antibody that prevents the hemagglutinin low pH fusogenic transition.

    ID: 2015846

    Description: epitope description:A: S152, N153, W169, G174, S175, S202, T203, Q205, E206, T208, S209, G241, L242; C: T142, T144, P178, V179, N181 antigen name:Hema...

    Publication: 11886266;
  39. Heightened immune response to autocitrullinated Porphyromonas gingivalis peptidylarginine deiminase: a potential mechanism for breaching immunologic t...

    ID: 2015856

    Description: epitope description:KALRAWFNAGRSELAVSV + CITR(R4, R11) antigen name:Probable peptidylarginine deiminase host organism:Homo sapiens

    Publication: 23463691;
  40. Heightened immune response to autocitrullinated Porphyromonas gingivalis peptidylarginine deiminase: a potential mechanism for breaching immunologic t...

    ID: 2015858

    Description: epitope description:YVLVVEGNGIRETMKILK + CITR(R11) antigen name:Probable peptidylarginine deiminase host organism:Homo sapiens

    Publication: 23463691;
  41. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015884

    Description: epitope description:LPNSCTANTYWCNDME host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;
  42. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015885

    Description: epitope description:STSLCTMSTYYCADT host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;
  43. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015897

    Description: epitope description:MTGDCKHWQNACFWSS host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;
  44. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015899

    Description: epitope description:IKGDCLGWQVQCMAAV host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;
  45. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015908

    Description: epitope description:DMMRCTTTRWKCGTDM host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;
  46. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015909

    Description: epitope description:VMGDCNESNAFCAHLR host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;
  47. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2015914

    Description: epitope description:MTGDCKHWQNACFWSS host organism:Homo sapiens

    Publication: 9174614;
  48. Thymine and guanine base specificity of human myeloma proteins with anti-DNA activity.

    ID: 2015924

    Description: epitope description:I11 host organism:Homo sapiens antibody name:ROU

    Publication: 3771789;
  49. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015933

    Description: epitope description:QQPFPQTQQPQQLF antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  50. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015934

    Description: epitope description:QQPQQLFPQSQQPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  51. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015936

    Description: epitope description:QQFSQPQQQFPQPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  52. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015937

    Description: epitope description:QQFPQPQQPQQSFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  53. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015939

    Description: epitope description:QQQPPFIQPSLQQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  54. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015948

    Description: epitope description:QCAAIHTIIHSIIM antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  55. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015952

    Description: epitope description:LPLYQQQQVGQGTL antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  56. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015955

    Description: epitope description:QPQQPAQLEAIRSL antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  57. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2015956

    Description: epitope description:LEAIRSLVLQTLPT antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 23963475;
  58. Characterization of antigenic domains and epitopes in the ORF3 protein of a Chinese isolate of avian hepatitis E virus.

    ID: 2018883

    Description: epitope description:QPSGALNNAPKEPSAPPLLPTLSPRQVLARYQM antigen name:Protein ORF3 host organism:Mus musculus BALB/c

    Publication: 24021883;
  59. Characterization of antigenic domains and epitopes in the ORF3 protein of a Chinese isolate of avian hepatitis E virus.

    ID: 2018885

    Description: epitope description:QPSGALNNAPKEPSAPPLLP antigen name:Protein ORF3 host organism:Mus musculus BALB/c

    Publication: 24021883;
  60. Characterization of antigenic domains and epitopes in the ORF3 protein of a Chinese isolate of avian hepatitis E virus.

    ID: 2018890

    Description: epitope description:QPSGALNNAPKEPSAPPLLP antigen name:Protein ORF3 host organism:Gallus gallus

    Publication: 24021883;
  61. Characterisation of mouse monoclonal antibodies targeting linear epitopes on Chikungunya virus E2 glycoprotein.

    ID: 2018898

    Description: epitope description:ADAERAGLFV antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:F-G6(F6)

    Publication: 24134938;
  62. Characterisation of mouse monoclonal antibodies targeting linear epitopes on Chikungunya virus E2 glycoprotein.

    ID: 2018903

    Description: epitope description:VPTEGLEVTW antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:E-G6(A6)

    Publication: 24134938;
  63. Characterisation of mouse monoclonal antibodies targeting linear epitopes on Chikungunya virus E2 glycoprotein.

    ID: 2018909

    Description: epitope description:THPFHHDPPV antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:O-G12(B1)

    Publication: 24134938;
  64. Characterisation of mouse monoclonal antibodies targeting linear epitopes on Chikungunya virus E2 glycoprotein.

    ID: 2018911

    Description: epitope description:GEEPNYQEEW antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:A-A9(A1)

    Publication: 24134938;
  65. Characterisation of mouse monoclonal antibodies targeting linear epitopes on Chikungunya virus E2 glycoprotein.

    ID: 2018912

    Description: epitope description:VPTEGLEVTW antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:E-G6(A6)

    Publication: 24134938;
  66. Inhibitory mechanism of an allosteric antibody targeting the glucagon receptor.

    ID: 2018916

    Description: epitope description:L32, W36, K64, Y65, Y84, L85, P86, W87, R108, P110, R111, G112, Q113, R116, Q122 antigen name:Glucagon receptor host organism:Mus ...

    Publication: 24189067;
  67. Antigen-specific immunomodulation for type 1 diabetes by novel recombinant antibodies directed against diabetes-associates auto-reactive T cell epitop...

    ID: 2018928

    Description: epitope description:NFFRMVISNPAAT antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens antibody name:G1H12

    Publication: 24090977;
  68. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2018948

    Description: epitope description:VSRQE antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D10

    Publication: 23987307;
  69. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2018955

    Description: epitope description:VSRQE antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D10

    Publication: 23987307;
  70. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2018974

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23987307;
  71. Expression of p44 variant-specific antibodies in sheep persistently infected with Anaplasma phagocytophilum.

    ID: 2019037

    Description: epitope description:VPSDTTNDNAKAVAGDLTKL antigen name:Other Anaplasma phagocytophilum (agent of human granulocytic ehrlichiosis) protein host organism...

    Publication: 23992798;
  72. Characterization of antigenic domains and epitopes in the ORF3 protein of a Chinese isolate of avian hepatitis E virus.

    ID: 2019039

    Description: epitope description:QPSGALNNAPKEPSAPPLLPTLSPRQVLARYQM antigen name:Protein ORF3 host organism:Gallus gallus

    Publication: 24021883;
  73. Expression of p44 variant-specific antibodies in sheep persistently infected with Anaplasma phagocytophilum.

    ID: 2019040

    Description: epitope description:ALAKTSGKDIVQFAKAVGVS antigen name:p44 outer membrane protein (UniProt:S5PK73) host organism:Ovis aries

    Publication: 23992798;
  74. Expression of p44 variant-specific antibodies in sheep persistently infected with Anaplasma phagocytophilum.

    ID: 2019043

    Description: epitope description:QYAKYASETANSSGASKAEV antigen name:p44 outer membrane protein (UniProt:S5PK73) host organism:Ovis aries

    Publication: 23992798;
  75. Expression of p44 variant-specific antibodies in sheep persistently infected with Anaplasma phagocytophilum.

    ID: 2019052

    Description: epitope description:TTAETLKHFIKETLKEDGNG antigen name:Other Anaplasma phagocytophilum (agent of human granulocytic ehrlichiosis) protein host organism...

    Publication: 23992798;
  76. Expression of p44 variant-specific antibodies in sheep persistently infected with Anaplasma phagocytophilum.

    ID: 2019054

    Description: epitope description:KKFSKFVEDVKIGEKNWPTG antigen name:Other Anaplasma phagocytophilum (agent of human granulocytic ehrlichiosis) protein host organism...

    Publication: 23992798;
  77. Characterization of causative allergens for wheat-dependent exercise-induced anaphylaxis sensitized with hydrolyzed wheat proteins in facial soap.

    ID: 2019055

    Description: epitope description:QFLQPQQPFPQQPQ + DEAM(Q1, Q4, Q6, Q7, Q11, Q12, Q14) antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapi...

    Publication: 23963475;
  78. Suppression of allergen-specific B lymphocytes by chimeric protein-engineered antibodies.

    ID: 2019057

    Description: epitope description:NQSLDLAEQELVDCASQHGC antigen name:Der p 1 host organism:Homo sapiens

    Publication: 24021574;
  79. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019139

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23987307;
  80. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019142

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23987307;
  81. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019144

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23987307;
  82. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019151

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23987307;
  83. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019152

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23987307;
  84. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019153

    Description: epitope description:IVSRQEKGKS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23987307;
  85. Identification of a novel infection-enhancing epitope on dengue prM using a dengue cross-reacting monoclonal antibody.

    ID: 2019154

    Description: epitope description:VSRQE antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4D10

    Publication: 23987307;
  86. Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic poly...

    ID: 2019186

    Description: epitope description:A32, G33, Y36, Q37, W39, E40, R43, Q47, F65, M67, Y68, Y87, P89, W90, R113, H115, E119 antigen name:Gastric inhibitory polypeptide...

    Publication: 23689510;
  87. Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic poly...

    ID: 2019188

    Description: epitope description:A32, G33, Y36, Q37, W39, E40, R43, Q47, F65, M67, Y68, Y87, P89, W90, R113, H115, E119 antigen name:Gastric inhibitory polypeptide...

    Publication: 23689510;
  88. Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic poly...

    ID: 2019189

    Description: epitope description:A32, G33, Y36, Q37, W39, E40, R43, Q47, F65, M67, Y68, Y87, P89, W90, R113, H115, E119 antigen name:Gastric inhibitory polypeptide...

    Publication: 23689510;
  89. Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic poly...

    ID: 2019192

    Description: epitope description:A32, G33, Y36, Q37, W39, E40, R43, Q47, F65, M67, Y68, Y87, P89, W90, R113, H115, E119 antigen name:Gastric inhibitory polypeptide...

    Publication: 23689510;
  90. Immune history shapes specificity of pandemic H1N1 influenza antibody responses.

    ID: 2019201

    Description: epitope description:K147 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:1009-3F01, EM-4C04, 1009-3B06

    Publication: 23857983;
  91. Extensive deamidation at asparagine residue 279 accounts for weak immunoreactivity of tau with RD4 antibody in Alzheimer's disease brain.

    ID: 2019221

    Description: epitope description:VQIINKKLDLSNVQSKC + DEAM(N5) antigen name:Microtubule-associated protein tau host organism:Oryctolagus cuniculus New Zealand White...

    Publication: 24252707;
  92. Extensive deamidation at asparagine residue 279 accounts for weak immunoreactivity of tau with RD4 antibody in Alzheimer's disease brain.

    ID: 2019222

    Description: epitope description:VQIINKKLDLSNVQSKC + DEAM(N5) antigen name:Microtubule-associated protein tau host organism:Oryctolagus cuniculus New Zealand White...

    Publication: 24252707;
  93. Antibodies against cisplatin-modified DNA and cisplatin-modified (di)nucleotides.

    ID: 2019247

    Description: epitope description:cis-diammine[d(pApG)]platinum host organism:Oryctolagus cuniculus antibody name:NKI-A68

    Publication: 1855275;
  94. Antibodies against cisplatin-modified DNA and cisplatin-modified (di)nucleotides.

    ID: 2019250

    Description: epitope description:cis-diammine[bis(dGMP)]platinum host organism:Oryctolagus cuniculus antibody name:NKI-A68

    Publication: 1855275;
  95. Antibodies against cisplatin-modified DNA and cisplatin-modified (di)nucleotides.

    ID: 2019254

    Description: epitope description:cis-diammine[bis(dGMP)]platinum host organism:Oryctolagus cuniculus antibody name:NKI-A10

    Publication: 1855275;
  96. Antibodies against cisplatin-modified DNA and cisplatin-modified (di)nucleotides.

    ID: 2019256

    Description: epitope description:triammine(dGMP)platinum host organism:Oryctolagus cuniculus antibody name:NKI-A39

    Publication: 1855275;
  97. Antibodies against cisplatin-modified DNA and cisplatin-modified (di)nucleotides.

    ID: 2019257

    Description: epitope description:triammine(dGMP)platinum host organism:Oryctolagus cuniculus antibody name:NKI-A39

    Publication: 1855275;
  98. Identification of the epitopes of monoclonal antibodies against P74 of Helicoverpa armigera nucleopolyhedrovirus.

    ID: 2019267

    Description: epitope description:TNDTDQLFPERFEGFFNEAYC antigen name:p74 host organism:Mus musculus BALB/c antibody name:21E1

    Publication: 24306759;
  99. Differential accessibility of a rotavirus VP6 epitope in trimers comprising type I, II, or III channels as revealed by binding of a human rotavirus VP...

    ID: 2019271

    Description: epitope description:A198, I199, N200, A201, P202, A203, N204, I205, Q206, Q207, F208, E209, H210, I211, V212, Q213, L214, R215, P309, N310, A311, Q312...

    Publication: 24155406;
  100. Immunization of N terminus of enterovirus 71 VP4 elicits cross-protective antibody responses.

    ID: 2019275

    Description: epitope description:STQRSGSH antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 24320792;

Displaying 100 of 1,510,353 results for " "