Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Immunogenic assessment of plant-produced human papillomavirus type 16 L1/L2 chimaeras.

    ID: 2006266

    Description: epitope description:GFGAMDF antigen name:Major capsid protein L1 host organism:Mus musculus antibody name:CamVir1

    Publication: 23924054;

  2. Exploiting the Burkholderia pseudomallei acute phase antigen BPSL2765 for structure-based epitope discovery/design in structural vaccinology.

    ID: 2006267

    Description: epitope description:RSVYFDFDSYSVQDQYQALLQQHAQYLK antigen name:Putative OmpA family lipoprotein host organism:Oryctolagus cuniculus New Zealand White a...

    Publication: 23993463;

  3. Immunogenic assessment of plant-produced human papillomavirus type 16 L1/L2 chimaeras.

    ID: 2006282

    Description: epitope description:GFGAMDF antigen name:Major capsid protein L1 host organism:Mus musculus antibody name:CamVir1

    Publication: 23924054;

  4. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody.

    ID: 2006430

    Description: epitope description:T50, L305, G307, I309, D310 antigen name:Fusion protein (F) host organism:Homo sapiens

    Publication: 23955151;

  5. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody.

    ID: 2006431

    Description: epitope description:T50, L305, G307, I309, D310 antigen name:Fusion protein (F) host organism:Homo sapiens

    Publication: 23955151;

  6. Analysis of cross-reactive antibodies recognizing the fusion loop of envelope protein and correlation with neutralizing antibody titers in Nicaraguan ...

    ID: 2006448

    Description: epitope description:W101, F108 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24069496;

  7. Analysis of cross-reactive antibodies recognizing the fusion loop of envelope protein and correlation with neutralizing antibody titers in Nicaraguan ...

    ID: 2006450

    Description: epitope description:W101, F108 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24069496;

  8. TOC1: characterization of a selective oligomeric tau antibody.

    ID: 2006577

    Description: epitope description:RSRTPSLPTPPTREPK antigen name:Microtubule-associated protein tau host organism:Mus musculus antibody name:TOC1

    Publication: 23979027;

  9. Constraining enzyme conformational change by an antibody leads to hyperbolic inhibition.

    ID: 2006756

    Description: epitope description:E17, N18, A19, M20, P21, W22, N23, E118, D144, A145, Q146, S148, H149 antigen name:Dihydrofolate reductase (UniProt:P0ABQ4) host o...

    Publication: 21238460;

  10. How insulin engages its primary binding site on the insulin receptor.

    ID: 2006808

    Description: epitope description:E238, P249, T250, L260, D261, R263, V265, E266, T267, C268, P269, P270, P271, Y272, H274, N308, N309 antigen name:Insulin receptor...

    Publication: 23302862;

  11. A novel M2e based flu vaccine formulation for dogs.

    ID: 2006864

    Description: epitope description:MSLLTEVETPTRNGWECKCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 24098576;

  12. A novel M2e based flu vaccine formulation for dogs.

    ID: 2006965

    Description: epitope description:MSLLTEVETPTRNGWGCRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 24098576;

  13. The binding sites of monoclonal antibodies to the non-reducing end of Francisella tularensis O-antigen accommodate mainly the terminal saccharide.

    ID: 2006991

    Description: epitope description:beta-D-QuipN4Fm-(1->4)-alpha-D-GalpNAcAN-(1->4)-alpha-D-GalpNAcAN-(1->3)-beta-DQuipNAc antigen name:lipopolysaccharide host organi...

    Publication: 23844703;

  14. The binding sites of monoclonal antibodies to the non-reducing end of Francisella tularensis O-antigen accommodate mainly the terminal saccharide.

    ID: 2007000

    Description: epitope description:beta-D-QuipN4Fm-(1->4)-alpha-D-GalpNAcAN-(1->4)-alpha-D-GalpNAcAN-(1->3)-beta-DQuipNAc-(1->2)-beta-D-QuipN4Fm-(1->4)-alpha-D-GalpN...

    Publication: 23844703;

  15. Identification of B cell epitopes in Lassa virus

    ID: 2007004

    Description: epitope description:SIINHKF antigen name:Pre-glycoprotein polyprotein GP complex host organism:Homo sapiens antibody name:19.7E

  16. Identification of B cell epitopes in Lassa virus

    ID: 2007008

    Description: epitope description:SDAHKKNLYDHAL antigen name:Pre-glycoprotein polyprotein GP complex host organism:Homo sapiens antibody name:39.3G

  17. Identification of B cell epitopes in Lassa virus

    ID: 2007011

    Description: epitope description:CNYSKY antigen name:Pre-glycoprotein polyprotein GP complex host organism:Homo sapiens antibody name:36.9F

  18. Identification of B cell epitopes in Lassa virus

    ID: 2007016

    Description: epitope description:SDAHKKNLYDHAL antigen name:Pre-glycoprotein polyprotein GP complex host organism:Homo sapiens antibody name:37.4E

  19. Identification of B cell epitopes in Lassa virus

    ID: 2007017

    Description: epitope description:EGKDTPGGY antigen name:Pre-glycoprotein polyprotein GP complex host organism:Homo sapiens antibody name:37.2D

  20. Thermodynamic signatures of the antigen binding site of mAb 447-52D targeting the third variable region of HIV-1 gp120.

    ID: 2007039

    Description: epitope description:CRIHIGPGRAFYTC + OX(C1, C14) host organism:Homo sapiens antibody name:447-52D

    Publication: 23944979;

  21. Thermodynamic signatures of the antigen binding site of mAb 447-52D targeting the third variable region of HIV-1 gp120.

    ID: 2007042

    Description: epitope description:KRIHIGPGRAFYTT antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:447-52D

    Publication: 23944979;

  22. Structural basis for the recognition of C20:2-alphaGalCer by the invariant natural killer T cell receptor-like antibody L363.

    ID: 2007044

    Description: epitope description:V90, V93, S94, R97, D98, E101, L102, L163, K166, V167, L168, A170, D171, G173 antigen name:Antigen-presenting glycoprotein CD1d1 h...

    Publication: 22110136;

  23. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2007087

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:Clone 10

    Publication: 23761636;

  24. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2007092

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 23761636;

  25. Insight into structural diversity of influenza virus haemagglutinin.

    ID: 2007099

    Description: epitope description:E129, R130, F131, E132, P135, T137, S138, K180, S181, I183, Y270 antigen name:Hemagglutinin host organism:Mus musculus BALB/c anti...

    Publication: 23636824;

  26. Epitope recognition in HLA-DR3 transgenic mice immunized to TSH-R protein or peptides.

    ID: 2007177

    Description: epitope description:ISRIYVSIDATLSQLES host organism:Mus musculus HLA-DR3 Tg

    Publication: 23592747;

  27. Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies.

    ID: 2007228

    Description: epitope description:N278, T280, N281, N282, A283, K284, N355, S365, G366, G367, D368, I371, T449, R450, D451, G452, G453, A454, N455, N456 antigen nam...

    Publication: 23911655;

  28. Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies.

    ID: 2007331

    Description: epitope description:N278, T280, N282, A283, N355, K357, S365, G366, G367, D368, I371, Q426, T449, R450, D451, G452, G453, N455, E460, G467 antigen nam...

    Publication: 23911655;

  29. Ligand recognition by anti-DNA autoantibodies. Affinity, specificity, and mode of binding.

    ID: 2007338

    Description: epitope description:dT21 host organism:Mus musculus MLR/lpr antibody name:7B3, 4B2, 10F4

    Publication: 8634294;

  30. Ligand recognition by anti-DNA autoantibodies. Affinity, specificity, and mode of binding.

    ID: 2007361

    Description: epitope description:dT5 host organism:Mus musculus MLR/lpr antibody name:15D8, 9F11, 15B10, 8D8, 11F8

    Publication: 8634294;

  31. Ligand recognition by anti-DNA autoantibodies. Affinity, specificity, and mode of binding.

    ID: 2007363

    Description: epitope description:dT5 host organism:Mus musculus MLR/lpr antibody name:15D8, 9F11, 15B10

    Publication: 8634294;

  32. Ligand recognition by anti-DNA autoantibodies. Affinity, specificity, and mode of binding.

    ID: 2007364

    Description: epitope description:dT5 host organism:Mus musculus MLR/lpr antibody name:15D8, 9F11, 15B10, 8D8, 11F8

    Publication: 8634294;

  33. Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies.

    ID: 2007431

    Description: epitope description:K96, L121, T122, T259, T280, N281, N282, A283, K284, S365, G366, G367, D368, E370, I371, N419, M420, W421, T424, G425, Q426, T449,...

    Publication: 23911655;

  34. Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies.

    ID: 2007432

    Description: epitope description:N278, T280, N281, N282, A283, K284, N355, S365, G366, G367, D368, I371, T449, R450, D451, G452, G453, A454, N455, N456 antigen nam...

    Publication: 23911655;

  35. Multidonor analysis reveals structural elements, genetic determinants, and maturation pathway for HIV-1 neutralization by VRC01-class antibodies.

    ID: 2007437

    Description: epitope description:K96, L121, N272, S274, D275, N276, A277, K278, S358, G359, G360, D361, I364, V421, G422, Q423, T446, R447, D448, G449, G450, N451,...

    Publication: 23911655;

  36. Ligand recognition by anti-DNA autoantibodies. Affinity, specificity, and mode of binding.

    ID: 2007458

    Description: epitope description:dT5 host organism:Mus musculus MLR/lpr antibody name:9F11

    Publication: 8634294;

  37. Immunization against a saccharide epitope accelerates clearance of experimental gonococcal infection.

    ID: 2007596

    Description: epitope description:CGPIPVLDENGLFAPGPC host organism:Mus musculus BALB/c

    Publication: 24009500;

  38. Redefining an epitope of a malaria vaccine candidate, with antibodies against the N-terminal MSA-2 antigen of Plasmodium harboring non-natural peptide...

    ID: 2007599

    Description: epitope description:KNESKYSNTFINNAYNMSIR + MCM(F10, I11) host organism:Aotus

    Publication: 23836419;

  39. A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation.

    ID: 2008232

    Description: epitope description:R28, K31, R32, G34, D36, G37, G40, I41, S42, A44, N45, V139, R140, V148 antigen name:Lysozyme C host organism:Camelus dromedarius ...

    Publication: 23919586;

  40. A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation.

    ID: 2008235

    Description: epitope description:R28, K31, R32, G34, D36, G37, G40, I41, S42, A44, N45, V139, R140, V148 antigen name:Lysozyme C host organism:Camelus dromedarius ...

    Publication: 23919586;

  41. A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation.

    ID: 2008236

    Description: epitope description:R28, K31, R32, G34, D36, G37, G40, I41, S42, A44, N45, V139, R140, V148 antigen name:Lysozyme C host organism:Camelus dromedarius ...

    Publication: 23919586;

  42. Clostridium difficile 027/BI/NAP1 encodes a hypertoxic and antigenically variable form of TcdB.

    ID: 2008388

    Description: epitope description:HYFSPETGKAFK antigen name:Toxin B host organism:Oryctolagus cuniculus

    Publication: 23935501;

  43. Clostridium difficile 027/BI/NAP1 encodes a hypertoxic and antigenically variable form of TcdB.

    ID: 2008391

    Description: epitope description:DSGDISSTVINFS antigen name:Toxin B host organism:Oryctolagus cuniculus

    Publication: 23935501;

  44. Expression and purification of the nucleocapsid protein of Schmallenberg virus, and preparation and characterization of a monoclonal antibody against ...

    ID: 2008503

    Description: epitope description:KMVLHKTAQPSVDLTFGGVKFTVVNN antigen name:nucleocapsid protein host organism:Mus musculus BALB/c antibody name:2C8

    Publication: 23988909;

  45. Expression and purification of the nucleocapsid protein of Schmallenberg virus, and preparation and characterization of a monoclonal antibody against ...

    ID: 2008506

    Description: epitope description:KMVLHKTAQPSVDLTFGGVKFTVVNN antigen name:nucleocapsid protein host organism:Mus musculus BALB/c antibody name:2C8

    Publication: 23988909;

  46. A unique and conserved neutralization epitope in H5N1 influenza viruses identified by an antibody against the A/Goose/Guangdong/1/96 hemagglutinin.

    ID: 2008513

    Description: epitope description:G62, N61, V63, P65, R69, E85, N88, E91, P90, H126, E128, Y287, N289, N291 antigen name:Hemagglutinin host organism:Mus musculus an...

    Publication: 24049169;

  47. A unique and conserved neutralization epitope in H5N1 influenza viruses identified by an antibody against the A/Goose/Guangdong/1/96 hemagglutinin.

    ID: 2008521

    Description: epitope description:D59, D61, V63, K64, R69, E85, N88, P90, E91, H126, E128, E286, Y287, N289, N291 antigen name:Hemagglutinin host organism:Mus muscu...

    Publication: 24049169;

  48. A unique and conserved neutralization epitope in H5N1 influenza viruses identified by an antibody against the A/Goose/Guangdong/1/96 hemagglutinin.

    ID: 2008525

    Description: epitope description:D59, D61, V63, K64, R69, E85, N88, P90, E91, H126, E128, E286, Y287, N289, N291 antigen name:Hemagglutinin host organism:Mus muscu...

    Publication: 24049169;

  49. A unique and conserved neutralization epitope in H5N1 influenza viruses identified by an antibody against the A/Goose/Guangdong/1/96 hemagglutinin.

    ID: 2008527

    Description: epitope description:D59, D61, V63, K64, R69, E85, N88, P90, E91, H126, E128, E286, Y287, N289, N291 antigen name:Hemagglutinin host organism:Mus muscu...

    Publication: 24049169;

  50. A unique and conserved neutralization epitope in H5N1 influenza viruses identified by an antibody against the A/Goose/Guangdong/1/96 hemagglutinin.

    ID: 2008532

    Description: epitope description:G62, N61, V63, P65, R69, E85, N88, E91, P90, H126, E128, Y287, N289, N291 antigen name:Hemagglutinin host organism:Mus musculus an...

    Publication: 24049169;

  51. Antigen-activated dendritic cells ameliorate influenza A infections.

    ID: 2008571

    Description: epitope description:NDATYQRTRALVRTG antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 23934125;

  52. Protective immunity against Trichinella spiralis infection induced by a multi-epitope vaccine in a murine model.

    ID: 2008627

    Description: epitope description:LPWHFKSRHRYQ host organism:Mus musculus BALB/c

    Publication: 24130862;

  53. Protective immunity against Trichinella spiralis infection induced by a multi-epitope vaccine in a murine model.

    ID: 2008633

    Description: epitope description:SHWNSHSTPARA host organism:Mus musculus antibody name:8F12

    Publication: 24130862;

  54. Protective immunity against Trichinella spiralis infection induced by a multi-epitope vaccine in a murine model.

    ID: 2008637

    Description: epitope description:LSTPYSKSQAST host organism:Mus musculus

    Publication: 24130862;

  55. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989029

    Description: epitope description:TSVWLLCRTRNLCITP antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  56. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989032

    Description: epitope description:NLCITPYKLAPNAQVP antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  57. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989034

    Description: epitope description:PNAQVPILLALLCCIK antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  58. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989038

    Description: epitope description:HAGVIRIQTSAMFGLK antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  59. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989042

    Description: epitope description:DLAYMSFMNGKTQKSI antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  60. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989048

    Description: epitope description:LARPYIADCSNCGHGR antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  61. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989052

    Description: epitope description:PYMAKCVRCAVGS antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  62. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989059

    Description: epitope description:PIAIEDIRGDAHAGYI antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  63. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989077

    Description: epitope description:HVYDHLKETSAGYITM antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  64. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989085

    Description: epitope description:SDYTTACTNLKQCRAY antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  65. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989087

    Description: epitope description:GDYTTTCTDLKQCRAY antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  66. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989088

    Description: epitope description:GEHTTTCTDVKQCRAY antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  67. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989091

    Description: epitope description:AKSYSQCTKTSQCRAY antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  68. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989098

    Description: epitope description:PPKRVWAQESGEGNPHGWPHEV antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 23922704;

  69. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989099

    Description: epitope description:PPKRVWAQESGEGNPHGWPHEV antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  70. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1989113

    Description: epitope description:LARPYIADCPNCGHSR antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  71. Immunogenicity of recombinant proteins consisting of Plasmodium vivax circumsporozoite protein allelic variant-derived epitopes fused with Salmonella ...

    ID: 1989139

    Description: epitope description:DRADGQPAGD antigen name:Circumsporozoite protein, putative host organism:Mus musculus BALB/c antibody name:2F2

    Publication: 23863502;

  72. Immunogenicity of recombinant proteins consisting of Plasmodium vivax circumsporozoite protein allelic variant-derived epitopes fused with Salmonella ...

    ID: 1989171

    Description: epitope description:APGANQEGGAA antigen name:Circumsporozoite protein host organism:Mus musculus C57BL/6

    Publication: 23863502;

  73. Monoclonal human anti-DNA antibodies from EB virus-transformed lymphocytes of systemic lupus erythematosus (SLE) patients.

    ID: 1989195

    Description: epitope description:(dT)10 host organism:Homo sapiens antibody name:NE-1, NE-28

    Publication: 2413066;

  74. Monoclonal human anti-DNA antibodies from EB virus-transformed lymphocytes of systemic lupus erythematosus (SLE) patients.

    ID: 1989196

    Description: epitope description:(dT)10 host organism:Homo sapiens antibody name:NE-28

    Publication: 2413066;

  75. Monoclonal human anti-DNA antibodies from EB virus-transformed lymphocytes of systemic lupus erythematosus (SLE) patients.

    ID: 1989197

    Description: epitope description:(dT)10 host organism:Homo sapiens

    Publication: 2413066;

  76. Self-adjuvanting influenza candidate vaccine presenting epitopes for cell-mediated immunity on a proteinaceous multivalent nanoplatform.

    ID: 1989218

    Description: epitope description:EALMEWLKTRPILSPLTK antigen name:Matrix protein 1 host organism:Oryctolagus cuniculus

    Publication: 23880363;

  77. Self-adjuvanting influenza candidate vaccine presenting epitopes for cell-mediated immunity on a proteinaceous multivalent nanoplatform.

    ID: 1989221

    Description: epitope description:LTKGILGFVFTLTVPSER antigen name:Matrix protein 1 host organism:Oryctolagus cuniculus

    Publication: 23880363;

  78. Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihydrofolate reductase of Escheric...

    ID: 1989259

    Description: epitope description:V10, D11, H114, I115, D116, E118, F140, S150, Y151, C152 antigen name:Dihydrofolate reductase (UniProt:P0ABQ4) host organism:Lama ...

    Publication: 23911607;

  79. Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihydrofolate reductase of Escheric...

    ID: 1989263

    Description: epitope description:V10, D11, H114, I115, D116, E118, F140, S150, Y151, C152 antigen name:Dihydrofolate reductase (UniProt:P0ABQ4) host organism:Lama ...

    Publication: 23911607;

  80. Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihydrofolate reductase of Escheric...

    ID: 1989311

    Description: epitope description:V10, D11, H114, I115, D116, E118, F140, S150, Y151, C152 antigen name:Dihydrofolate reductase (UniProt:P0ABQ4) host organism:Lama ...

    Publication: 23911607;

  81. Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihydrofolate reductase of Escheric...

    ID: 1989313

    Description: epitope description:E17, N18, A19, M20, P21, W22, N23, L28, F31, E48, S49, I50, R52, L54, A145, Q146 antigen name:Dihydrofolate reductase (UniProt:P0A...

    Publication: 23911607;

  82. Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6.

    ID: 1989465

    Description: epitope description:R28, R29, E51, A54, V70, E73, L95, S96, D98, E115, R141, W157, W183, N185, A201, P225, H226, F228, W242, S243, F266, M269 antigen ...

    Publication: 21944579;

  83. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains.

    ID: 1989486

    Description: epitope description:K346, D347, L349, H370, L372, P373, V374, R377, D379, F381, T382, Q408, H433, S442 antigen name:Epidermal growth factor receptor h...

    Publication: 23791944;

  84. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains.

    ID: 1989487

    Description: epitope description:Y316, R334, T363, K399, E400, E424, I425, R427, R429, K454, E455, S457, K479, L480, F481, G482, T483, S484 antigen name:Epidermal ...

    Publication: 23791944;

  85. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains.

    ID: 1989488

    Description: epitope description:Y316, E317, R334, S364, K399, E400, T402, E424, I425, R427, R429, K454, E455, S457, K478, K479, L480, F481, G482 antigen name:Epid...

    Publication: 23791944;

  86. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains.

    ID: 1989492

    Description: epitope description:K346, D347, L349, H370, L372, P373, V374, R377, D379, F381, T382, Q408, H433, S442 antigen name:Epidermal growth factor receptor h...

    Publication: 23791944;

  87. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains.

    ID: 1989495

    Description: epitope description:Y316, E317, R334, S364, K399, E400, T402, E424, I425, R427, R429, K454, E455, S457, K478, K479, L480, F481, G482 antigen name:Epid...

    Publication: 23791944;

  88. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains.

    ID: 1989496

    Description: epitope description:P373, V374, R377, L406, Q408, Q432, H433, Q435, F436, V441, S442, I462, S464, G465, K467, K489, I490, I491, S492, N493, G495, N497...

    Publication: 23791944;

  89. New ELISAs with high specificity for soluble oligomers of amyloid beta-protein detect natural Abeta oligomers in human brain but not CSF.

    ID: 1989503

    Description: epitope description:DAEFR antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:3D6

    Publication: 23375565;

  90. Protective efficacy and immunogenicity of a combinatory DNA vaccine against Influenza A Virus and the Respiratory Syncytial Virus.

    ID: 1989514

    Description: epitope description:IYSTVASSL antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 23967287;

  91. Characterization of a serologic marker candidate for development of a live-attenuated DIVA vaccine against porcine reproductive and respiratory syndro...

    ID: 1989546

    Description: epitope description:AVKQGVVNLVKYAK antigen name:Membrane protein host organism:Sus scrofa

    Publication: 23892102;

  92. Antigenic Peptides Capable of Inducing Specific Antibodies for Detection of the Major Alterations Found in Type 2B Von Willebrand Disease.

    ID: 1989549

    Description: epitope description:RPSELRR antigen name:von Willebrand factor host organism:Mus musculus Swiss

    Publication: 23970904;

  93. In vitro and in vivo characterization of designed immunogens derived from the CD-helix of the stem of influenza hemagglutinin.

    ID: 1989832

    Description: epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQH antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1

    Publication: 23625724;

  94. In vitro and in vivo characterization of designed immunogens derived from the CD-helix of the stem of influenza hemagglutinin.

    ID: 1989890

    Description: epitope description:EANKLAEKTRRQLRENA + AIB(A2, A6) host organism:Mus musculus BALB/c

    Publication: 23625724;

  95. In vitro and in vivo characterization of designed immunogens derived from the CD-helix of the stem of influenza hemagglutinin.

    ID: 1989891

    Description: epitope description:EANKLAEKTRRQLRENA + AIB(A2, A6) host organism:Mus musculus BALB/c

    Publication: 23625724;

  96. Analysis of murine B-cell epitopes on Eastern equine encephalitis virus glycoprotein E2.

    ID: 1989901

    Description: epitope description:FKGKLHVPFVPV antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:5D11, 8C2

    Publication: 23512478;

  97. Analysis of murine B-cell epitopes on Eastern equine encephalitis virus glycoprotein E2.

    ID: 1989905

    Description: epitope description:TPVGRELYSHPPEHGT antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:4D9

    Publication: 23512478;

  98. Characterization of a discontinuous neutralizing epitope on glycoprotein B of human cytomegalovirus.

    ID: 1989907

    Description: epitope description:Y364, K379 antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:SM5-1

    Publication: 23740990;

  99. Characterization of a discontinuous neutralizing epitope on glycoprotein B of human cytomegalovirus.

    ID: 1989949

    Description: epitope description:Y364, K379 antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:SM5-1

    Publication: 23740990;

  100. Characterization of a discontinuous neutralizing epitope on glycoprotein B of human cytomegalovirus.

    ID: 1989951

    Description: epitope description:Y364, K379 antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:SM5-1

    Publication: 23740990;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston