Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4179

    Description: epitope description:GDHCEGLGVL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  2. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4182

    Description: epitope description:ANAEALNNLL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  3. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4187

    Description: epitope description:STETVEVSQG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  4. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4222

    Description: epitope description:MSFVPGQENA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  5. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4226

    Description: epitope description:GQQKQLLPRW antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  6. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4231

    Description: epitope description:VYVRPIIEDY antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  7. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4233

    Description: epitope description:LQFGYTSRSM antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  8. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4238

    Description: epitope description:GNYRLPSNKP antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  9. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4247

    Description: epitope description:RELQKRLYSN antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  10. Identification of the epitope of a monoclonal antibody to DJ-1.

    ID: 4454

    Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

    Publication: 15663963;

  11. Pathogenic human thyroglobulin peptides in HLA-DR3 transgenic mouse model of autoimmune thyroiditis.

    ID: 4543

    Description: epitope description:ENLLKEAIRAIFPSR antigen name:Thyroglobulin host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

    Publication: 15474522;

  12. Pathogenic human thyroglobulin peptides in HLA-DR3 transgenic mouse model of autoimmune thyroiditis.

    ID: 4549

    Description: epitope description:LSSVVVDPSIRHFDV antigen name:Thyroglobulin host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

    Publication: 15474522;

  13. Novel biomarker of HTLV-1-associated disease: specific appearance of antibody recognizing the receptor-binding site on HTLV-1 envelope protein.

    ID: 4603

    Description: epitope description:DHILEPSIPWKSKLLTLVQL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15504252;

  14. Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

    ID: 4708

    Description: epitope description:LNPKTNKWEDK antigen name:Asp f 1 host organism:Homo sapiens

    Publication: 15138181;

  15. Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

    ID: 4711

    Description: epitope description:INQQLNPK antigen name:Asp f 1 host organism:Homo sapiens

    Publication: 15138181;

  16. Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

    ID: 4716

    Description: epitope description:LNPKTNKWEDKRY antigen name:Asp f 1 host organism:Homo sapiens

    Publication: 15138181;

  17. Recognition of a cell-surface oligosaccharide of pathogenic Salmonella by an antibody Fab fragment.

    ID: 4737

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody ...

    Publication: 1713710;

  18. Discovery of human antibodies against the C5aR target using phage display technology.

    ID: 1036

    Description: epitope description:MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN antigen name:C5a anaphylatoxin chemotactic receptor 1 host organism:Homo sapiens antibody name:IgG...

    Publication: 15706605;

  19. Identification of a transiently exposed VE-cadherin epitope that allows for specific targeting of an antibody to the tumor neovasculature.

    ID: 1048

    Description: epitope description:DWIWNQMHIDEEKNE antigen name:Cadherin-5 host organism:Rattus norvegicus Lewis antibody name:E4G10

    Publication: 15701713;

  20. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1077

    Description: epitope description:CTDVSTAIHADQLTPAWRIYSTGNNVFQTQAG antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston