Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648456

    Description: epitope description:NKALPAP antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  2. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648459

    Description: epitope description:LPAPIEK antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  3. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648460

    Description: epitope description:PAPIEKT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  4. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648461

    Description: epitope description:APIEKTI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  5. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648470

    Description: epitope description:ISKAKGQ antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  6. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648473

    Description: epitope description:KAKGQPR antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  7. Antibody epitopes probed by immunoselected phage-display library peptides in members of a family with various rheumatic manifestations.

    ID: 1648646

    Description: epitope description:ADGGAQGTA host organism:Homo sapiens

    Publication: 8978954;

  8. Antibody epitopes probed by immunoselected phage-display library peptides in members of a family with various rheumatic manifestations.

    ID: 1648655

    Description: epitope description:LSSREPQAR host organism:Homo sapiens

    Publication: 8978954;

  9. Mimotopes identified by phage display for the monoclonal antibody CII-C1 to type II collagen.

    ID: 1648810

    Description: epitope description:RAAPFGNQW host organism:Mus musculus DBA/1 antibody name:CII-C1

    Publication: 9693968;

  10. Mimotopes identified by phage display for the monoclonal antibody CII-C1 to type II collagen.

    ID: 1648814

    Description: epitope description:CESAQRPFGCC host organism:Mus musculus DBA/1 antibody name:CII-C1

    Publication: 9693968;

  11. Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer's amyloid-beta oligomers.

    ID: 1648854

    Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:Im8, Im18

    Publication: 19361429;

  12. Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer's amyloid-beta oligomers.

    ID: 1648856

    Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:A1, A13, A18, A19

    Publication: 19361429;

  13. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648883

    Description: epitope description:AKVFSRRGGNVTLPCKFYR antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  14. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648887

    Description: epitope description:DASLVITDLTLEDYGRYKCEVIEGL antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  15. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648895

    Description: epitope description:NDGAQIAKVGQIFAAWKLLGYDRCD antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  16. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648897

    Description: epitope description:PRRRCSPSEAAVRFVGFPDKKHKLY antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  17. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648902

    Description: epitope description:SKPQSETL antigen name:Collagen alpha-5(IV) chain host organism:Rattus norvegicus antibody name:H52

    Publication: 8548560;

  18. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648906

    Description: epitope description:KKPTPSTL antigen name:Collagen alpha-1(IV) chain host organism:Rattus norvegicus antibody name:H11

    Publication: 8548560;

  19. Identification of an immunodominant B-cell epitope in bovine type II collagen and the production of antibodies to type II collagen by immunization wit...

    ID: 1647607

    Description: epitope description:PAGGPGFPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1283603;

  20. Identification of peptide motifs recognized by a human IgG autoanti-IgE antibody using a phage display library.

    ID: 1648015

    Description: epitope description:GGRHPSPMGTFDTQT host organism:Homo sapiens

    Publication: 10848928;

  21. T-cell epitope of alpha3 chain of type IV collagen induces severe glomerulonephritis.

    ID: 1648142

    Description: epitope description:MRGFIFTRHSQTT antigen name:Protein LOC100911572 host organism:Rattus norvegicus Wistar

    Publication: 12969147;

  22. Epitope mapping of anti-glomerular basement membrane (GBM) antibodies with synthetic peptides.

    ID: 1648144

    Description: epitope description:PGSCLEEFRSAPFIECHGRG antigen name:Collagen alpha-1(IV) chain host organism:Homo sapiens

    Publication: 8809141;

  23. Epitope mapping of anti-glomerular basement membrane (GBM) antibodies with synthetic peptides.

    ID: 1648146

    Description: epitope description:FWLATIERSEMFKKPTPSTL antigen name:Collagen alpha-1(IV) chain host organism:Homo sapiens

    Publication: 8809141;

  24. Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration.

    ID: 1648281

    Description: epitope description:KETELLYEYHDTGTAIISKN antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 17112315;

  25. Extracellular neurofibrillary tangles are immunopositive for the 40 carboxy-terminal sequence of beta-amyloid protein.

    ID: 1648284

    Description: epitope description:GVVIA antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:B42

    Publication: 9862635;

  26. Extracellular neurofibrillary tangles are immunopositive for the 40 carboxy-terminal sequence of beta-amyloid protein.

    ID: 1648288

    Description: epitope description:GSNKGAIIGLM antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:B-mid

    Publication: 9862635;

  27. Repeated helical epitopes of defined amino acid sequence in human type III collagen identified by monoclonal antibodies.

    ID: 1648292

    Description: epitope description:GAPGLRGGAG + HYL(P3) antigen name:Collagen alpha-1(III) chain host organism:Mus musculus A.SW/SN antibody name:1F8

    Publication: 1376414;

  28. Detection of collagenase-induced damage of collagen by 9A4, a monoclonal C-terminal neoepitope antibody.

    ID: 1648301

    Description: epitope description:GPPGPQG antigen name:Collagen alpha-1(II) chain host organism:Mus musculus BALB/c antibody name:9A4

    Publication: 10517180;

  29. Novel monoclonal antibodies against proteolipid protein peptide 139-151 demonstrate demyelination and myelin uptake by macrophages in MS and marmoset ...

    ID: 1648352

    Description: epitope description:HCLGKWLGHPDKF antigen name:Myelin proteolipid protein host organism:Mus musculus SJL antibody name:J1-03

    Publication: 11525809;

  30. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648361

    Description: epitope description:FLFPPKP antigen name:Immunoglobulin host organism:Homo sapiens antibody name:RF113

    Publication: 7939417;

  31. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648368

    Description: epitope description:PKDTLMI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  32. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648375

    Description: epitope description:SRTPEVT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  33. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648379

    Description: epitope description:EVTCVVV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  34. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648383

    Description: epitope description:VVVDVSH antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  35. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648384

    Description: epitope description:VVDVSHE antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  36. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648391

    Description: epitope description:EDPQVKF antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 7939417;

  37. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648392

    Description: epitope description:DPQVKFN antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 7939417;

  38. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648397

    Description: epitope description:KFNWYVD antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  39. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648404

    Description: epitope description:DGVQVHN antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  40. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648412

    Description: epitope description:KTKPREQ antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  41. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648910

    Description: epitope description:ERMFRK antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus antibody name:h32

    Publication: 8548560;

  42. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648912

    Description: epitope description:FSSAP antigen name:Collagen alpha-4(IV) chain host organism:Rattus norvegicus antibody name:H44

    Publication: 8548560;

  43. X-ray structure of the PHF core C-terminus: insight into the folding of the intrinsically disordered protein tau in Alzheimer's disease.

    ID: 1648933

    Description: epitope description:TDHGAE antigen name:Other Homo sapiens (human) protein host organism:Mus musculus C3H antibody name:MN423

    Publication: 18061582;

  44. Epitope-specific recognition of type II collagen by rheumatoid arthritis antibodies is shared with recognition by antibodies that are arthritogenic in...

    ID: 1648942

    Description: epitope description:ERGLKGHRGFT antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 12355481;

  45. Epitope-specific recognition of type II collagen by rheumatoid arthritis antibodies is shared with recognition by antibodies that are arthritogenic in...

    ID: 1648945

    Description: epitope description:MPGERGAAGIAGPK antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 12355481;

  46. Epitope-specific recognition of type II collagen by rheumatoid arthritis antibodies is shared with recognition by antibodies that are arthritogenic in...

    ID: 1648951

    Description: epitope description:ARGLTGRPGDA antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 12355481;

  47. Endogenous C-terminal fragments of beta-amyloid precursor protein from Xenopus laevis skin exudate.

    ID: 1648957

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 17270477;

  48. A rheumatoid factor specific mimotope identified by a peptide display library.

    ID: 1648963

    Description: epitope description:SLITAARGAPS host organism:Homo sapiens antibody name:B'20

    Publication: 10520896;

  49. A rheumatoid factor specific mimotope identified by a peptide display library.

    ID: 1648993

    Description: epitope description:LLPWLDGHPM host organism:Homo sapiens antibody name:B'20

    Publication: 10520896;

  50. Epitopes on the CB-11 peptide of type II collagen recognized by antibodies from patients with rheumatoid arthritis.

    ID: 1649060

    Description: epitope description:DAGPQGKVGPS antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 7688639;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston