ID: 1648456
Description: epitope description:NKALPAP antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648459
Description: epitope description:LPAPIEK antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648460
Description: epitope description:PAPIEKT antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648461
Description: epitope description:APIEKTI antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648470
Description: epitope description:ISKAKGQ antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648473
Description: epitope description:KAKGQPR antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648646
Description: epitope description:ADGGAQGTA host organism:Homo sapiens
Publication: 8978954;ID: 1648655
Description: epitope description:LSSREPQAR host organism:Homo sapiens
Publication: 8978954;Mimotopes identified by phage display for the monoclonal antibody CII-C1 to type II collagen.
ID: 1648810
Description: epitope description:RAAPFGNQW host organism:Mus musculus DBA/1 antibody name:CII-C1
Publication: 9693968;Mimotopes identified by phage display for the monoclonal antibody CII-C1 to type II collagen.
ID: 1648814
Description: epitope description:CESAQRPFGCC host organism:Mus musculus DBA/1 antibody name:CII-C1
Publication: 9693968;ID: 1648854
Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:Im8, Im18
Publication: 19361429;ID: 1648856
Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:A1, A13, A18, A19
Publication: 19361429;ID: 1648883
Description: epitope description:AKVFSRRGGNVTLPCKFYR antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c
Publication: 9777960;ID: 1648887
Description: epitope description:DASLVITDLTLEDYGRYKCEVIEGL antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c
Publication: 9777960;ID: 1648895
Description: epitope description:NDGAQIAKVGQIFAAWKLLGYDRCD antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c
Publication: 9777960;ID: 1648897
Description: epitope description:PRRRCSPSEAAVRFVGFPDKKHKLY antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c
Publication: 9777960;ID: 1648902
Description: epitope description:SKPQSETL antigen name:Collagen alpha-5(IV) chain host organism:Rattus norvegicus antibody name:H52
Publication: 8548560;ID: 1648906
Description: epitope description:KKPTPSTL antigen name:Collagen alpha-1(IV) chain host organism:Rattus norvegicus antibody name:H11
Publication: 8548560;ID: 1647607
Description: epitope description:PAGGPGFPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar
Publication: 1283603;ID: 1648015
Description: epitope description:GGRHPSPMGTFDTQT host organism:Homo sapiens
Publication: 10848928;T-cell epitope of alpha3 chain of type IV collagen induces severe glomerulonephritis.
ID: 1648142
Description: epitope description:MRGFIFTRHSQTT antigen name:Protein LOC100911572 host organism:Rattus norvegicus Wistar
Publication: 12969147;Epitope mapping of anti-glomerular basement membrane (GBM) antibodies with synthetic peptides.
ID: 1648144
Description: epitope description:PGSCLEEFRSAPFIECHGRG antigen name:Collagen alpha-1(IV) chain host organism:Homo sapiens
Publication: 8809141;Epitope mapping of anti-glomerular basement membrane (GBM) antibodies with synthetic peptides.
ID: 1648146
Description: epitope description:FWLATIERSEMFKKPTPSTL antigen name:Collagen alpha-1(IV) chain host organism:Homo sapiens
Publication: 8809141;ID: 1648281
Description: epitope description:KETELLYEYHDTGTAIISKN antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens
Publication: 17112315;ID: 1648284
Description: epitope description:GVVIA antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:B42
Publication: 9862635;ID: 1648288
Description: epitope description:GSNKGAIIGLM antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:B-mid
Publication: 9862635;ID: 1648292
Description: epitope description:GAPGLRGGAG + HYL(P3) antigen name:Collagen alpha-1(III) chain host organism:Mus musculus A.SW/SN antibody name:1F8
Publication: 1376414;ID: 1648301
Description: epitope description:GPPGPQG antigen name:Collagen alpha-1(II) chain host organism:Mus musculus BALB/c antibody name:9A4
Publication: 10517180;ID: 1648352
Description: epitope description:HCLGKWLGHPDKF antigen name:Myelin proteolipid protein host organism:Mus musculus SJL antibody name:J1-03
Publication: 11525809;ID: 1648361
Description: epitope description:FLFPPKP antigen name:Immunoglobulin host organism:Homo sapiens antibody name:RF113
Publication: 7939417;ID: 1648368
Description: epitope description:PKDTLMI antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648375
Description: epitope description:SRTPEVT antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648379
Description: epitope description:EVTCVVV antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648383
Description: epitope description:VVVDVSH antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648384
Description: epitope description:VVDVSHE antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648391
Description: epitope description:EDPQVKF antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens
Publication: 7939417;ID: 1648392
Description: epitope description:DPQVKFN antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens
Publication: 7939417;ID: 1648397
Description: epitope description:KFNWYVD antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648404
Description: epitope description:DGVQVHN antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648412
Description: epitope description:KTKPREQ antigen name:Immunoglobulin host organism:Homo sapiens
Publication: 7939417;ID: 1648910
Description: epitope description:ERMFRK antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus antibody name:h32
Publication: 8548560;ID: 1648912
Description: epitope description:FSSAP antigen name:Collagen alpha-4(IV) chain host organism:Rattus norvegicus antibody name:H44
Publication: 8548560;ID: 1648933
Description: epitope description:TDHGAE antigen name:Other Homo sapiens (human) protein host organism:Mus musculus C3H antibody name:MN423
Publication: 18061582;ID: 1648942
Description: epitope description:ERGLKGHRGFT antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens
Publication: 12355481;ID: 1648945
Description: epitope description:MPGERGAAGIAGPK antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens
Publication: 12355481;ID: 1648951
Description: epitope description:ARGLTGRPGDA antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens
Publication: 12355481;Endogenous C-terminal fragments of beta-amyloid precursor protein from Xenopus laevis skin exudate.
ID: 1648957
Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus
Publication: 17270477;A rheumatoid factor specific mimotope identified by a peptide display library.
ID: 1648963
Description: epitope description:SLITAARGAPS host organism:Homo sapiens antibody name:B'20
Publication: 10520896;A rheumatoid factor specific mimotope identified by a peptide display library.
ID: 1648993
Description: epitope description:LLPWLDGHPM host organism:Homo sapiens antibody name:B'20
Publication: 10520896;ID: 1649060
Description: epitope description:DAGPQGKVGPS antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens
Publication: 7688639;