Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463092

    Description: epitope description:QSRGEAR antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 16944047;

  2. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463094

    Description: epitope description:QVSFLQGDQSENE antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  3. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463097

    Description: epitope description:QSRGEARESYRETGPSRA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  4. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463116

    Description: epitope description:ARAAHLPTGTPLD antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  5. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463117

    Description: epitope description:AAHLPTGTPLDID antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  6. Serum and mucosal antibodies of infected foals recognized two distinct epitopes of VapA of Rhodococcus equi.

    ID: 1463126

    Description: epitope description:VSFQYNAVGPYLNINFFDSS antigen name:Virulence associated protein VapA host organism:Equus caballus antibody name:Horse serum

    Publication: 12443830;

  7. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416696

    Description: epitope description:VVERLGDYLLEQGM antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  8. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415780

    Description: epitope description:IPKVPPGPNITATYGDKWLDAKSTWYGKPTG antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 3

    Publication: 11511525;

  9. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415781

    Description: epitope description:GYKDVDKPPFSGMTGCGNTPIFKSGRGC antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 4

    Publication: 11511525;

  10. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415782

    Description: epitope description:VRYTTEGGTKTEAEDVIPEGWKADTSYESK antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 5

    Publication: 11511525;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston