Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475401

    Description: epitope description:KKGVITQVKY antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:patient sera

    Publication: 9751845;

  2. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475411

    Description: epitope description:LRPCEQHLMQ antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 9186485;

  3. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475417

    Description: epitope description:QRCDLDVESGG antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 9186485;

  4. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475450

    Description: epitope description:NGPQEIYIQQGNGIF antigen name:Glycinin G2 host organism:Homo sapiens antibody name:human sera

    Publication: 11112857;

  5. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475467

    Description: epitope description:QHTFNLKSQQARQVK antigen name:Glycinin G2 host organism:Homo sapiens antibody name:human sera

    Publication: 11112857;

  6. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475471

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  7. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475482

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  8. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475493

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  9. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475507

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  10. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475511

    Description: epitope description:TKINADNPVPILELE antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  11. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475516

    Description: epitope description:QNTEEMENLSDRVAS antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  12. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475521

    Description: epitope description:QNTEEMENLSDRVAS antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  13. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475522

    Description: epitope description:TGYRYDSRTGFFATN antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  14. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475527

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  15. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475528

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  16. Fine specificity of the antibody response to a synthetic peptide from the fusion protein and protection against measles virus-induced encephalitis in ...

    ID: 1475535

    Description: epitope description:PDKILTYIAADHC antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6 antibody name:mouse serum

    Publication: 9400973;

  17. Fine specificity of the antibody response to a synthetic peptide from the fusion protein and protection against measles virus-induced encephalitis in ...

    ID: 1475536

    Description: epitope description:PDKILTYIAADHC antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6 antibody name:mouse serum

    Publication: 9400973;

  18. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475538

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  19. Peptide-based candidate vaccine against respiratory syncytial virus.

    ID: 1475544

    Description: epitope description:FVPCSICSNNPTCWAICKRIP antigen name:Major surface glycoprotein G host organism:Macaca mulatta

    Publication: 15755607;

  20. Development of improved SNAP25 endopeptidase immuno-assays for botulinum type A and E toxins.

    ID: 1475597

    Description: epitope description:TQNRQIDR antigen name:Other Carassius auratus (goldfish) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17976638;

  21. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475623

    Description: epitope description:FALREQAQQNECQIQ antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  22. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475624

    Description: epitope description:QNECQIQKLNALKPD antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  23. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475626

    Description: epitope description:RIESEGGFIETWNPN antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  24. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482637

    Description: epitope description:TVDNPASTTNKDKLFAVWK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  25. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482638

    Description: epitope description:TVDNPASTTNKDKLFAVWK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  26. Characterization of HTLV envelope seroreactivity in large granular lymphocyte leukemia.

    ID: 1482639

    Description: epitope description:LENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15725471;

  27. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482643

    Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  28. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482645

    Description: epitope description:VQTRHVVQHRSRSESSIESF antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  29. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482652

    Description: epitope description:KLEFFTYSRFDMELTFVVTAN antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  30. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482654

    Description: epitope description:PPGAPVPEKWDDYTWQTSSNP antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  31. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482656

    Description: epitope description:PPGAPVPEKWDDYTWQTSSNP antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  32. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482660

    Description: epitope description:SNAYSHFYDGFSKVPLKDQS antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  33. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482665

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  34. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482673

    Description: epitope description:AALGDSLYGAASLNDFGILA antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  35. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482676

    Description: epitope description:NKDKLFAVWK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  36. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482679

    Description: epitope description:TVDNPASTTNKDKLFAVWK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  37. Deconstructing the antigenic profile of a protective epitope from measles virus fusion protein using overlapping peptides.

    ID: 1482683

    Description: epitope description:CYTTGTIINQDPDKILTYIAADHC antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 10506658;

  38. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482688

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  39. Immunochemical studies of tobacco mosaic virus--V. Localization of four epitopes in the protein subunit by inhibition tests with synthetic peptides an...

    ID: 1482693

    Description: epitope description:TVVQRQFSEVWKPSPQVTVR antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 6191202;

  40. Deconstructing the antigenic profile of a protective epitope from measles virus fusion protein using overlapping peptides.

    ID: 1482696

    Description: epitope description:TGTIINQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 10506658;

  41. Immunochemical studies of tobacco mosaic virus--V. Localization of four epitopes in the protein subunit by inhibition tests with synthetic peptides an...

    ID: 1482699

    Description: epitope description:YNAVLDPLITALLGTFDTR antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 6191202;

  42. Deconstructing the antigenic profile of a protective epitope from measles virus fusion protein using overlapping peptides.

    ID: 1482704

    Description: epitope description:NQDPDKILTYIAADH antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 10506658;

  43. Deconstructing the antigenic profile of a protective epitope from measles virus fusion protein using overlapping peptides.

    ID: 1482710

    Description: epitope description:DPDKILTYIAA antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 10506658;

  44. Immunochemical studies of tobacco mosaic virus--V. Localization of four epitopes in the protein subunit by inhibition tests with synthetic peptides an...

    ID: 1482714

    Description: epitope description:TVVQRQFSEVWKPSPQVTVR antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 6191202;

  45. Immunochemical studies of tobacco mosaic virus--V. Localization of four epitopes in the protein subunit by inhibition tests with synthetic peptides an...

    ID: 1482715

    Description: epitope description:YNAVLDPLITALLGTFDTR antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 6191202;

  46. Failure to detect evidence of human T-lymphotropic virus (HTLV) type I and type II in blood donors with isolated gag antibodies to HTLV-I/II.

    ID: 1482719

    Description: epitope description:PRIPPKPCPICVGPHWKSDCPT antigen name:Gag polyprotein host organism:Homo sapiens

    Publication: 1627806;

  47. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482781

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  48. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482783

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  49. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482786

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  50. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482787

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  51. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482789

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  52. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482791

    Description: epitope description:NKDKLFAVWK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  53. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482800

    Description: epitope description:TVDNPASTTNKDKLFAVWK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  54. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482810

    Description: epitope description:NKDKLFTVWK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  55. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482820

    Description: epitope description:TVDNSASTKNKDKLFTVWK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  56. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482821

    Description: epitope description:TVDNSASTKNKDKLFTVWK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  57. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482828

    Description: epitope description:KLEFFTYSRFDMELTFVVTAN antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  58. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482834

    Description: epitope description:SNAYSHFYDGFSKVPLKDQS antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  59. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482836

    Description: epitope description:CPRPPRAVAYYGPGVDYK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 2983321;

  60. Enhanced antigenicity of a four-contact-residue epitope of the measles virus hemagglutinin protein by phage display libraries: evidence of a helical s...

    ID: 1482845

    Description: epitope description:SYLPQLG host organism:Mus musculus antibody name:BH129

    Publication: 9798648;

  61. Enhanced antigenicity of a four-contact-residue epitope of the measles virus hemagglutinin protein by phage display libraries: evidence of a helical s...

    ID: 1482846

    Description: epitope description:SYLPQLG host organism:Mus musculus antibody name:BH129

    Publication: 9798648;

  62. Enhanced antigenicity of a four-contact-residue epitope of the measles virus hemagglutinin protein by phage display libraries: evidence of a helical s...

    ID: 1482854

    Description: epitope description:SELPQWD host organism:Mus musculus antibody name:BH129

    Publication: 9798648;

  63. New approach for generation of neutralizing antibody against human T-cell leukaemia virus type-I (HTLV-I) using phage clones.

    ID: 1482857

    Description: epitope description:LPHSNL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus antibody name:LAT-27

    Publication: 11818146;

  64. New approach for generation of neutralizing antibody against human T-cell leukaemia virus type-I (HTLV-I) using phage clones.

    ID: 1482861

    Description: epitope description:LPHSNL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus antibody name:LAT-27

    Publication: 11818146;

  65. The immune response to and expression of cross-reactive retroviral gag sequences in autoimmune disease.

    ID: 1482868

    Description: epitope description:PPPPSSPTHDPPDSDPQIPPP antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1280512;

  66. The immune response to and expression of cross-reactive retroviral gag sequences in autoimmune disease.

    ID: 1482870

    Description: epitope description:PPPPSSPTHDPPDSDPQIPPP antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1280512;

  67. The immune response to and expression of cross-reactive retroviral gag sequences in autoimmune disease.

    ID: 1482872

    Description: epitope description:PPPPSSPTHDPPDSDPQIPPP antigen name:Gag-Pro-Pol polyprotein host organism:Oryctolagus cuniculus

    Publication: 1280512;

  68. Identification of a neutralization epitope on the envelope gp46 antigen of human T cell leukemia virus type I and induction of neutralizing antibody b...

    ID: 1482883

    Description: epitope description:LPHSNL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH antibody name:LAT-27

    Publication: 1711082;

  69. Immune complex transfer enzyme immunoassay for (anti-human T-cell leukemia virus type I) IgG in serum using a synthetic peptide, Env gp46(188-209), as...

    ID: 1482926

    Description: epitope description:PPLLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1900332;

  70. New approach for generation of neutralizing antibody against human T-cell leukaemia virus type-I (HTLV-I) using phage clones.

    ID: 1482933

    Description: epitope description:LPHSNL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11818146;

  71. Induction of anti foot and mouth disease virus T and B cell responses in cattle immunized with a peptide representing ten amino acids of VP1.

    ID: 1482940

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Bos taurus Holstein-Friesian

    Publication: 9569465;

  72. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482944

    Description: epitope description:YVHDNC antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:mAb 2 and 8

    Publication: 9461548;

  73. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482945

    Description: epitope description:CDCDRTAA antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:mAb 21 and...

    Publication: 9461548;

  74. Characterization of monoclonal antibodies against a type SAT 2 foot-and-mouth disease virus.

    ID: 1482959

    Description: epitope description:V610 antigen name:Polyprotein host organism:Mus musculus antibody name:MAbs 2, 40, 27, 37

    Publication: 7691630;

  75. Characterization of monoclonal antibodies against a type SAT 2 foot-and-mouth disease virus.

    ID: 1482973

    Description: epitope description:G617 antigen name:Polyprotein host organism:Mus musculus antibody name:MAb 41

    Publication: 7691630;

  76. Characterization of monoclonal antibodies against a type SAT 2 foot-and-mouth disease virus.

    ID: 1482975

    Description: epitope description:S619 antigen name:Polyprotein host organism:Mus musculus antibody name:MAb 44

    Publication: 7691630;

  77. Characterization of monoclonal antibodies against a type SAT 2 foot-and-mouth disease virus.

    ID: 1482976

    Description: epitope description:S619 antigen name:Polyprotein host organism:Mus musculus antibody name:MAb 44

    Publication: 7691630;

  78. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482981

    Description: epitope description:CFGNSEY antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:mAb 6

    Publication: 9461548;

  79. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482982

    Description: epitope description:AGGSGRP antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9461548;

  80. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482984

    Description: epitope description:YVHDNC antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9461548;

  81. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482989

    Description: epitope description:YVHDNC antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9461548;

  82. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482991

    Description: epitope description:CFGNSEY antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9461548;

  83. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483019

    Description: epitope description:E223, K234 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:K1, K4, K6, K8, K9, K10, K11, K13, K14,...

    Publication: 12890622;

  84. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483024

    Description: epitope description:MSTLNTHGAF antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 12890622;

  85. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483026

    Description: epitope description:TDTRKDINTVTTVAQS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 12890622;

  86. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483032

    Description: epitope description:E223, K234 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:K8

    Publication: 12890622;

  87. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483034

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus

    Publication: 12887105;

  88. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483037

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus BALB/c

    Publication: 12887105;

  89. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483038

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus BALB/c

    Publication: 12887105;

  90. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483041

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus BALB/c

    Publication: 12887105;

  91. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483083

    Description: epitope description:HWYISKPQ host organism:Mus musculus BALB/c antibody name:MAb 19

    Publication: 9499058;

  92. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483096

    Description: epitope description:HPYISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  93. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483097

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  94. Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodi...

    ID: 1483098

    Description: epitope description:CDNPASTTNKDKDNPASTTNKDKDNPASTTNKDK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7535942;

  95. Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodi...

    ID: 1483107

    Description: epitope description:ARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7535942;

  96. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483135

    Description: epitope description:HPYISKPQ host organism:Mus musculus BALB/c antibody name:MAb 19

    Publication: 9499058;

  97. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483139

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  98. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483184

    Description: epitope description:PSDVSGLLLRPPPAP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  99. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483186

    Description: epitope description:SPSLPITMRFPARWRF antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  100. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483187

    Description: epitope description:LPWRAPSQPAAAFLF antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston