Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652916

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R7) antigen name:Filaggrin host organism:Mus musculus DBA/1

    Publication: 16585962;

  2. Heat shock protein and gliadin peptide promote development of peptidase antibodies in children with autism and patients with autoimmune disease.

    ID: 1652919

    Description: epitope description:LKQIAAHAGKEGAIIFQQVM antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 15138176;

  3. Identification and characterization of immunodominant B-cell epitope of the C-terminus of protective antigen of Bacillus anthracis.

    ID: 1652921

    Description: epitope description:AVGADESVVKEAHREVINS antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 19356802;

  4. Secretion of anti-citrulline-containing peptide antibody by B lymphocytes in rheumatoid arthritis.

    ID: 1652923

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R7) antigen name:Filaggrin host organism:Homo sapiens antibody name:Synovial fluid antibodies

    Publication: 11212174;

  5. Secretion of anti-citrulline-containing peptide antibody by B lymphocytes in rheumatoid arthritis.

    ID: 1652924

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R7) antigen name:Filaggrin host organism:Homo sapiens antibody name:Bone marrow antibodies

    Publication: 11212174;

  6. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652930

    Description: epitope description:DNASLARLDLERKVESLQEE antigen name:Vimentin host organism:Mus musculus DBA/1

    Publication: 16585962;

  7. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652935

    Description: epitope description:DVRQQYESVAAKNLQEAEEW + CITR(R3) antigen name:Vimentin host organism:Mus musculus C57BL/6 antibody name:D513

    Publication: 16585962;

  8. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652950

    Description: epitope description:CPTGCQLQEALLQQERPIRN + CITR(R16, R19) antigen name:Fibrinogen beta chain host organism:Mus musculus C57BL/6 antibody name:D513

    Publication: 16585962;

  9. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652957

    Description: epitope description:DVRQQYESVAAKNLQEAEEW antigen name:Vimentin host organism:Mus musculus C57BL/6 antibody name:D513

    Publication: 16585962;

  10. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652964

    Description: epitope description:RCHAANPNGRYYWGGQYTWD antigen name:Fibrinogen beta chain host organism:Mus musculus DBA/1 antibody name:1042, 1618

    Publication: 16585962;

  11. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652968

    Description: epitope description:TIHAHPGSRRGGRHGYHH antigen name:Other Homo sapiens (human) protein host organism:Mus musculus DBA/1 antibody name:1618

    Publication: 16585962;

  12. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652969

    Description: epitope description:TIHAHPGSRRGGRHGYHH antigen name:Other Homo sapiens (human) protein host organism:Mus musculus DBA/1 antibody name:1618

    Publication: 16585962;

  13. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652975

    Description: epitope description:CDDDDDNDGVPDSRDNCRLV antigen name:Cartilage oligomeric matrix protein host organism:Mus musculus DBA/1 antibody name:1618

    Publication: 16585962;

  14. Antibodies against citrullinated proteins enhance tissue injury in experimental autoimmune arthritis.

    ID: 1652982

    Description: epitope description:GEESRISLPLPNFSSLNLRE + CITR(R5, R20) antigen name:Vimentin host organism:Mus musculus DBA/1 antibody name:1042, 1618

    Publication: 16585962;

  15. Definition of extracellular localized epitopes of Hsp70 involved in an NK immune response.

    ID: 1652996

    Description: epitope description:GVLIQVYEGERAMTKDNNLLGRFELSGIPPAPGVPQIEVTFDI antigen name:Heat shock 70 kDa protein 1B host organism:Mus musculus antibody name:MA3...

    Publication: 9585177;

  16. Antibodies to the buried N terminus of rhinovirus VP4 exhibit cross-serotypic neutralization.

    ID: 1652998

    Description: epitope description:SGSHENQNILTNGSNQ antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19403680;

  17. Murine CD7 shares antigenic cross-reactivity with HSP-60.

    ID: 1653183

    Description: epitope description:TISANGDKDIG antigen name:60 kDa heat shock protein, mitochondrial host organism:Rattus norvegicus Sprague-Dawley antibody name:35C...

    Publication: 18642672;

  18. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653186

    Description: epitope description:RGLPGERG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  19. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653189

    Description: epitope description:PGERGRTG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  20. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653194

    Description: epitope description:RTGPAGAA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  21. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653199

    Description: epitope description:GAAGARGN antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  22. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653200

    Description: epitope description:AAGARGND antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  23. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653201

    Description: epitope description:AGARGNDG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  24. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653202

    Description: epitope description:GARGNDGQ antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  25. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653204

    Description: epitope description:RGNDGQPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  26. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653208

    Description: epitope description:GQPGPAGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  27. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653214

    Description: epitope description:GPPGPVGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  28. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653216

    Description: epitope description:PGPVGPAG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  29. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653217

    Description: epitope description:GPVGPAGG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  30. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653218

    Description: epitope description:PVGPAGGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  31. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653220

    Description: epitope description:GPAGGPGF antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  32. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653222

    Description: epitope description:AGGPGFPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  33. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653227

    Description: epitope description:FPGAPGAK antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  34. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653230

    Description: epitope description:APGAKGEA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  35. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653231

    Description: epitope description:PGAKGEAG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  36. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653241

    Description: epitope description:GARGPEGA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  37. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653243

    Description: epitope description:RGPEGAQG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  38. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653244

    Description: epitope description:GPEGAQGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  39. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653247

    Description: epitope description:GAQGPRGE antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  40. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653250

    Description: epitope description:GPRGEPGT antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  41. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649611

    Description: epitope description:RSLDFQATTMF antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  42. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649619

    Description: epitope description:SPRSGDLSVY antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  43. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649620

    Description: epitope description:SPRSGDLSVY antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  44. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649634

    Description: epitope description:KPISGHNSLF antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  45. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1649643

    Description: epitope description:NAKTKPR antigen name:Immunoglobulin host organism:Mus musculus antibody name:HP6069

    Publication: 7939417;

  46. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649682

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R9) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  47. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649683

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R9) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  48. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649684

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R11) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  49. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649688

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R16) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  50. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649689

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R16) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston