Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Characterization of a neutralizing monoclonal antibody directed at variable domain I of the major outer membrane protein of Chlamydia trachomatis C-co...

    ID: 15942

    Description: epitope description:LSN host organism:Mus musculus BALB/c antibody name:C10

    Publication: 7681045;

  2. Universal influenza B vaccine based on the maturational cleavage site of the hemagglutinin precursor.

    ID: 15953

    Description: epitope description:PAKLLKERGFFGAIAGFLE antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 15919893;

  3. Universal influenza B vaccine based on the maturational cleavage site of the hemagglutinin precursor.

    ID: 15968

    Description: epitope description:NVPEKQTRGIFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 15919893;

  4. Antigen capture enzyme-linked immunosorbent assay for specific detection of Reston Ebola virus nucleoprotein.

    ID: 15976

    Description: epitope description:DPDI antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Res2-6C8

    Publication: 12853385;

  5. Antigen capture enzyme-linked immunosorbent assay for specific detection of Reston Ebola virus nucleoprotein.

    ID: 15983

    Description: epitope description:DPDIGQSK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Res2-1D8

    Publication: 12853385;

  6. Antigen capture enzyme-linked immunosorbent assay for specific detection of Reston Ebola virus nucleoprotein.

    ID: 15985

    Description: epitope description:DPDIGQSK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Res2-1D8

    Publication: 12853385;

  7. Generation of antibodies to the signal peptide of the MPT83 lipoprotein of Mycobacterium tuberculosis.

    ID: 16019

    Description: epitope description:MINVQAKPAAAAS antigen name:Cell surface lipoprotein MPT83 host organism:Oryctolagus cuniculus

    Publication: 11841695;

  8. Generation of antibodies to the signal peptide of the MPT83 lipoprotein of Mycobacterium tuberculosis.

    ID: 16157

    Description: epitope description:MINVQAKPAAAAS antigen name:Cell surface lipoprotein MPT83 host organism:Oryctolagus cuniculus

    Publication: 11841695;

  9. Mapping of epitopes and structural analysis of antigenic sites in the nucleoprotein of rabies virus.

    ID: 16168

    Description: epitope description:RFFRDEKELQ antigen name:Nucleoprotein host organism:Mus musculus antibody name:mAb 12-2

    Publication: 10640549;

  10. Antibody responses to Four Corners hantavirus infections in the deer mouse (Peromyscus maniculatus): identification of an immunodominant region of the...

    ID: 16170

    Description: epitope description:QLVTARQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLG antigen name:Sin Nombre orthohantavirus protein host organism:Peromyscus maniculatus a...

    Publication: 7853538;

  11. A Japanese encephalitis virus peptide present on Johnson grass mosaic virus-like particles induces virus-neutralizing antibodies and protects mice aga...

    ID: 16231

    Description: epitope description:GRGDKQINHHWHKA antigen name:Genome polyprotein host organism:Mus musculus FVB/J

    Publication: 12610124;

  12. Immune response to synthetic peptides of dengue prM protein.

    ID: 16265

    Description: epitope description:CEDTITYKCPLLRQNEPEDIDCW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 11906771;

  13. Immune response to synthetic peptides of dengue prM protein.

    ID: 16273

    Description: epitope description:RQNEPEDIDCWCNSTSTWVTYGTCTTTGEHRREKRS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 11906771;

  14. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16295

    Description: epitope description:MSTLQELQENITA antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  15. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16296

    Description: epitope description:HEQQLVTARQKLK antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  16. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16311

    Description: epitope description:NSIDLEEPSGQTA antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  17. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16313

    Description: epitope description:DWKAIGAYILGFA antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  18. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16316

    Description: epitope description:RGRQAVKDNKGTRIRFKDDSSFEEVN antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  19. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16318

    Description: epitope description:GIRKPKHLYVSMP antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  20. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16322

    Description: epitope description:GRFRTIACGLFPA antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston