Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644294

    Description: epitope description:DIAAPGVGCA antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  2. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644301

    Description: epitope description:GCAGESHGPD antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  3. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644303

    Description: epitope description:AGESHGPDQG antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  4. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644304

    Description: epitope description:GESHGPDQGH antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  5. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644309

    Description: epitope description:PDQGHDTGSA antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  6. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644313

    Description: epitope description:HDTGSASAPA antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  7. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644314

    Description: epitope description:DTGSASAPAS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  8. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644316

    Description: epitope description:GSASAPASTS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  9. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644319

    Description: epitope description:SAPASTSTSS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  10. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644334

    Description: epitope description:SGSGATTTPT antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  11. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644336

    Description: epitope description:SGATTTPTDS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  12. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644342

    Description: epitope description:PTDSPSATID antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  13. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644343

    Description: epitope description:TDSPSATIDV antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  14. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644348

    Description: epitope description:ATIDVPSNCH antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  15. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644355

    Description: epitope description:NCHTHEGGQL antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  16. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644361

    Description: epitope description:YTTRR antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  17. Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer's amyloid-beta oligomers.

    ID: 1644381

    Description: epitope description:DAEFRHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:B2

    Publication: 19361429;

  18. CD40L disruption enhances Abeta vaccine-mediated reduction of cerebral amyloidosis while minimizing cerebral amyloid angiopathy and inflammation.

    ID: 1644647

    Description: epitope description:LVFFAEDV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4G8

    Publication: 18055209;

  19. Goodpasture syndrome. Localization of the epitope for the autoantibodies to the carboxyl-terminal region of the alpha 3(IV) chain of basement membrane...

    ID: 1644693

    Description: epitope description:SLNPERMFRKP antigen name:Collagen alpha-3(IV) chain host organism:Homo sapiens

    Publication: 1721062;

  20. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653252

    Description: epitope description:RGEPGTPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  21. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653263

    Description: epitope description:PAGAAGNP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  22. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653265

    Description: epitope description:GAAGNPGT antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  23. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653266

    Description: epitope description:AAGNPGTD antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  24. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653280

    Description: epitope description:GSAGAPGI antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  25. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653282

    Description: epitope description:AGAPGIAG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  26. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653283

    Description: epitope description:GAPGIAGA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  27. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653285

    Description: epitope description:PGIAGAPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  28. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653298

    Description: epitope description:GPPGPTGA antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  29. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653301

    Description: epitope description:GPTGASGP antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  30. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653302

    Description: epitope description:PTGASGPL antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  31. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653304

    Description: epitope description:GASGPLGP antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  32. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653306

    Description: epitope description:SGPLGPKG antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  33. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653312

    Description: epitope description:KGQTGEPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  34. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653313

    Description: epitope description:GQTGEPGI antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  35. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653314

    Description: epitope description:QTGEPGIA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  36. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653316

    Description: epitope description:GEPGIAGF antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  37. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653321

    Description: epitope description:AGFKGEQG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  38. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653322

    Description: epitope description:GFKGEQGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  39. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653337

    Description: epitope description:GVQGAPGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  40. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653342

    Description: epitope description:PGPAGEEG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  41. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653356

    Description: epitope description:EPGGAGPA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  42. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653365

    Description: epitope description:PPGERGAP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  43. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653372

    Description: epitope description:PGSRGFPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  44. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653373

    Description: epitope description:GSRGFPGQ antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  45. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653382

    Description: epitope description:GIAGPKGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  46. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653387

    Description: epitope description:KGPPGERG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  47. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653388

    Description: epitope description:GPPGERGS antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  48. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653393

    Description: epitope description:RGSPGAVG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  49. Identification of functional epitopes of Pseudomonas aeruginosa exotoxin A using synthetic peptides and subclone products.

    ID: 1709640

    Description: epitope description:AEEAFDLWNECAKACVLDLKDGVRSSRMSV antigen name:Exotoxin A host organism:Rattus norvegicus Sprague-Dawley

    Publication: 1700288;

  50. Identification of functional epitopes of Pseudomonas aeruginosa exotoxin A using synthetic peptides and subclone products.

    ID: 1709661

    Description: epitope description:DLDPSSIPDKEQAISALPDYASQPGKPPREDLK antigen name:Exotoxin A host organism:Rattus norvegicus Sprague-Dawley

    Publication: 1700288;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston