Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483188

    Description: epitope description:FLPWKAPSQP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  2. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483189

    Description: epitope description:FLPWRAPSQP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  3. Critical role of neighbouring sequences on the immunogenicity of the C3 poliovirus neutralization epitope expressed at the surface of recombinant bact...

    ID: 1483228

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1694613;

  4. Critical role of neighbouring sequences on the immunogenicity of the C3 poliovirus neutralization epitope expressed at the surface of recombinant bact...

    ID: 1483232

    Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1694613;

  5. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483264

    Description: epitope description:SLINDMPITNDQKKLMSNNV antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  6. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483290

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  7. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483292

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  8. Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

    ID: 1483331

    Description: epitope description:IVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQEQCCFLN antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 9609528;

  9. Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

    ID: 1483334

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 9609528;

  10. Cross-reactivity between immunodominant human T lymphotropic virus type I tax and neurons: implications for molecular mimicry.

    ID: 1483367

    Description: epitope description:KHFRETEV antigen name:Protein Tax-1 host organism:Mus musculus antibody name:Tab169, Tab 170, Tab 171

    Publication: 12404172;

  11. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483378

    Description: epitope description:PFFFSDVRSNFSKLV antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  12. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483393

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  13. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483405

    Description: epitope description:LKARDINDIFAILKN antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  14. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483411

    Description: epitope description:LKARDINDIFAILKN antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  15. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483415

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  16. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483417

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  17. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483419

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  18. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483421

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  19. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483426

    Description: epitope description:NEYIEKANITTDDK antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  20. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483447

    Description: epitope description:GSNDDLWHQWKRMYNKEYN antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;

  21. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483456

    Description: epitope description:NNRDVPASIDWREYGYVTE antigen name:Cathepsin L-like proteinase host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;

  22. The p12I, p13II, and p30II proteins encoded by human T-cell leukemia/lymphotropic virus type I open reading frames I and II are localized in three dif...

    ID: 1483458

    Description: epitope description:GGPRRSRPRLSSSKDSK antigen name:Accessory protein p30II host organism:Oryctolagus cuniculus

    Publication: 8445734;

  23. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483467

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;

  24. Protection against measles virus-induced encephalitis by anti-mimotope antibodies: the role of antibody affinity.

    ID: 1483480

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10873752;

  25. Protection against measles virus-induced encephalitis by anti-mimotope antibodies: the role of antibody affinity.

    ID: 1483481

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10873752;

  26. Intrinsic immunogenicity of an internal VP1 T-B epitope pair of type 1 poliovirus.

    ID: 1483500

    Description: epitope description:RSRSESSIESF antigen name:Genome polyprotein host organism:Mus musculus SJL antibody name:anti-VP1 (70-80)

    Publication: 1280759;

  27. A modified TMV-based vector facilitates the expression of longer foreign epitopes in tobacco.

    ID: 1483515

    Description: epitope description:PNLRGDLQVLA antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16337317;

  28. Biosensor characterization of antigenic site A of foot-and-mouth disease virus presented in different vector systems.

    ID: 1484451

    Description: epitope description:YTASARGDLAHLTTTHARHLPTSF + ACET(Y1) antigen name:Genome polyprotein host organism:Mus musculus antibody name:3E5

    Publication: 9684999;

  29. Biosensor characterization of antigenic site A of foot-and-mouth disease virus presented in different vector systems.

    ID: 1484460

    Description: epitope description:YTASARGDLAHLTTTHARHLPTSF + ACET(Y1) antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 9684999;

  30. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484478

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  31. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484480

    Description: epitope description:EVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  32. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484481

    Description: epitope description:LAGPCILRQLRHLPSRVRYPHYSLIKPESSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  33. Fine mapping of canine parvovirus B cell epitopes.

    ID: 1484483

    Description: epitope description:GQPAVRNERATGS antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1919526;

  34. Helper T-cell determinants in vaccine design.

    ID: 1484494

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2476143;

  35. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484517

    Description: epitope description:VPNLRGDLQVLAQKVART antigen name:Genome polyprotein host organism:Ovis aries

    Publication: 1690176;

  36. Enzyme immunoassay with synthetic peptides to detect anti-HTLV-I antibodies.

    ID: 1484525

    Description: epitope description:PPPPSSPTHDPPDSDPQIPPPYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1582023;

  37. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484530

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries antibody name:3E4, 5E11, 4C6-D6, 4C6-E5, 1C9, 7G7, 5D5, 5D9, 5F8...

    Publication: 1690176;

  38. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484531

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries antibody name:5D9, 5F8, 6B6, 2E6, 6C11, 4C6-E5

    Publication: 1690176;

  39. A hemagglutinin-derived peptide-vaccine ignored by virus-neutralizing passive antibodies, protects against murine measles encephalitis.

    ID: 1484532

    Description: epitope description:YAMGVGVELE antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10392626;

  40. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484535

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries antibody name:2E6, 6C11

    Publication: 1690176;

  41. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484539

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries

    Publication: 1690176;

  42. A hemagglutinin-derived peptide-vaccine ignored by virus-neutralizing passive antibodies, protects against murine measles encephalitis.

    ID: 1484559

    Description: epitope description:RSELSQLS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 10392626;

  43. The molecular basis of virus crossreactivity and neutralisation after immunisation with optimised chimeric peptides mimicking a putative helical epito...

    ID: 1484563

    Description: epitope description:KPNLSSKRSELSQLSMYRVF antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 9881686;

  44. Monoclonal antibodies against measles virus haemagglutinin react with synthetic peptides.

    ID: 1484565

    Description: epitope description:NPDREYDFRD antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:48

    Publication: 2474850;

  45. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484616

    Description: epitope description:EDSGSNGKKITCECTKPDS antigen name:Merozoite surface protein 1 host organism:Oryctolagus cuniculus New Zealand White antibody name:R...

    Publication: 17012909;

  46. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484617

    Description: epitope description:KPIVQYDNF antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Oryctolagus cuniculus Ne...

    Publication: 17012909;

  47. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484630

    Description: epitope description:SSPSSTKSSSPSNVKSAS antigen name:Rhoptry-associated protein 1, RAP1 host organism:Oryctolagus cuniculus New Zealand White antibody ...

    Publication: 17012909;

  48. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484631

    Description: epitope description:LATRLMKKFKAEIRDFF antigen name:Rhoptry-associated protein 1, RAP1 host organism:Oryctolagus cuniculus New Zealand White antibody n...

    Publication: 17012909;

  49. Lymphocyte recognition elements on the VP1 protein of Theiler's virus.

    ID: 1484638

    Description: epitope description:VDFVAEPVKLPENQT antigen name:Cardiovirus B protein host organism:Mus musculus CBA

    Publication: 7543873;

  50. Lymphocyte recognition elements on the VP1 protein of Theiler's virus.

    ID: 1484659

    Description: epitope description:LPSFCPDSSSGPQKT antigen name:Cardiovirus B protein host organism:Mus musculus CBA

    Publication: 7543873;

  51. Lymphocyte recognition elements on the VP1 protein of Theiler's virus.

    ID: 1484680

    Description: epitope description:LEVTVSALGMTRVAS antigen name:Cardiovirus B protein host organism:Mus musculus CBA

    Publication: 7543873;

  52. An epitope on the adenovirus fibre tail is common to all human subgroups.

    ID: 1484746

    Description: epitope description:DTFNPVYPYDTE antigen name:Fiber protein host organism:Mus musculus BALB/c antibody name:Mab 21

    Publication: 10893158;

  53. Identification of two ancillary subunits of Escherichia coli type 1 fimbriae by using antibodies against synthetic oligopeptides of fim gene products.

    ID: 1484754

    Description: epitope description:CKTANGTAIPIGGGSANVYVNLAPVV antigen name:Protein FimH host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2890622;

  54. Identification of two ancillary subunits of Escherichia coli type 1 fimbriae by using antibodies against synthetic oligopeptides of fim gene products.

    ID: 1484755

    Description: epitope description:CKTANGTAIPIGGGSANVYVNLAPVV antigen name:Protein FimH host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2890622;

  55. Expression of Shiga toxin epitopes in E. coli immunological characterization.

    ID: 1484757

    Description: epitope description:VEYTKYNDDDTFT antigen name:Shiga toxin subunit B host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2475438;

  56. Anti-peptide antibodies and proteases as structural probes for the lactose/H+ transporter of Escherichia coli: a loop around amino acid residue 130 fa...

    ID: 1484792

    Description: epitope description:MYYLKNTNF antigen name:Lactose permease host organism:Oryctolagus cuniculus

    Publication: 3521731;

  57. Anti-peptide antibodies and proteases as structural probes for the lactose/H+ transporter of Escherichia coli: a loop around amino acid residue 130 fa...

    ID: 1484794

    Description: epitope description:LHDINHISKSDT antigen name:Lactose permease host organism:Oryctolagus cuniculus

    Publication: 3521731;

  58. Anti-peptide antibodies and proteases as structural probes for the lactose/H+ transporter of Escherichia coli: a loop around amino acid residue 130 fa...

    ID: 1484796

    Description: epitope description:VAEFIEKVSRR antigen name:Lactose permease host organism:Oryctolagus cuniculus

    Publication: 3521731;

  59. Anti-peptide antibodies and proteases as structural probes for the lactose/H+ transporter of Escherichia coli: a loop around amino acid residue 130 fa...

    ID: 1484799

    Description: epitope description:EKVSRRSNFEF antigen name:Lactose permease host organism:Oryctolagus cuniculus

    Publication: 3521731;

  60. Anti-peptide antibodies and proteases as structural probes for the lactose/H+ transporter of Escherichia coli: a loop around amino acid residue 130 fa...

    ID: 1484802

    Description: epitope description:NRIGGKNA antigen name:Lactose permease host organism:Oryctolagus cuniculus

    Publication: 3521731;

  61. Anti-peptide antibodies and proteases as structural probes for the lactose/H+ transporter of Escherichia coli: a loop around amino acid residue 130 fa...

    ID: 1484805

    Description: epitope description:LLRRQVNEVA antigen name:Lactose permease host organism:Oryctolagus cuniculus

    Publication: 3521731;

  62. Localization of the major antigenic determinant of EDP208 pili at the N-terminus of the pilus protein.

    ID: 1484812

    Description: epitope description:TDLLAGGKDDVK antigen name:UniProt:S5GHB0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6185467;

  63. Peptide priming of a poliovirus neutralizing antibody response.

    ID: 1484850

    Description: epitope description:RSRSES antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6330847;

  64. Peptide priming of a poliovirus neutralizing antibody response.

    ID: 1484852

    Description: epitope description:RSRSES antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6330847;

  65. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484855

    Description: epitope description:SQKSADQSIDFGQL antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  66. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484857

    Description: epitope description:VSKPMDLDIELVN antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  67. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484859

    Description: epitope description:LDTNGGTGTAIV antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  68. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484860

    Description: epitope description:IVVQGAGKNVVFDG antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  69. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484862

    Description: epitope description:LHYTAVVKKSSAV antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  70. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484868

    Description: epitope description:GDANTLKDGENVL antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  71. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484872

    Description: epitope description:AFKGGNGAKKG antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  72. Gal-Gal pyelonephritis Escherichia coli pili linear immunogenic and antigenic epitopes.

    ID: 1484873

    Description: epitope description:LDTNGGTGTAIV antigen name:Pap fimbrial major pilin protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2580037;

  73. Inhibitory activity against sporozoites induced by antibodies directed against nonrepetitive regions of the circumsporozoite protein of Plasmodium viv...

    ID: 1484913

    Description: epitope description:CSVTCGVGVRVRSRVNA host organism:Saimiri sciureus antibody name:Monkey sera

    Publication: 1371470;

  74. Inhibitory activity against sporozoites induced by antibodies directed against nonrepetitive regions of the circumsporozoite protein of Plasmodium viv...

    ID: 1484917

    Description: epitope description:CSVTCGVGVRVRSRVNA host organism:Saimiri sciureus antibody name:Monkey sera

    Publication: 1371470;

  75. Inhibitory activity against sporozoites induced by antibodies directed against nonrepetitive regions of the circumsporozoite protein of Plasmodium viv...

    ID: 1484923

    Description: epitope description:VRVRSRVNAANKKPED host organism:Oryctolagus cuniculus antibody name:Rabbit Sera

    Publication: 1371470;

  76. Intranasal vaccination with peptides and cholera toxin subunit B as adjuvant to enhance mucosal and systemic immunity to respiratory syncytial virus.

    ID: 1484926

    Description: epitope description:SELLSLINDMPITNDQKKLMSNNV antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 17424945;

  77. Inhibitory activity against sporozoites induced by antibodies directed against nonrepetitive regions of the circumsporozoite protein of Plasmodium viv...

    ID: 1484930

    Description: epitope description:VRVRSRVNAANKKPED host organism:Oryctolagus cuniculus antibody name:Rabbit Sera

    Publication: 1371470;

  78. Monospecific polyclonal anti-anti-idiotypic antibodies to the carboxyterminal undecapeptide of the SV40 large tumour antigen.

    ID: 1484933

    Description: epitope description:KPPTPPPEPET antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c antibody name:PAb1605

    Publication: 7532873;

  79. Monospecific polyclonal anti-anti-idiotypic antibodies to the carboxyterminal undecapeptide of the SV40 large tumour antigen.

    ID: 1484962

    Description: epitope description:KPPTPPPEPET antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c antibody name:Ab-3

    Publication: 7532873;

  80. Importance of residues 2-9 in the immunoreactivity, subunit interactions, and activity of the beta 2 subunit of Escherichia coli tryptophan synthase.

    ID: 1484969

    Description: epitope description:TTLLNPYF antigen name:Tryptophan synthase beta chain host organism:Mus musculus antibody name:mAb19

    Publication: 7533160;

  81. Synthetic peptides of Shiga toxin B subunit induce antibodies which neutralize its biological activity.

    ID: 1484999

    Description: epitope description:VTGKVEYTKYNDDD antigen name:Shiga toxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3286503;

  82. Synthetic peptides of Shiga toxin B subunit induce antibodies which neutralize its biological activity.

    ID: 1485000

    Description: epitope description:VTGKVEYTKYNDDD antigen name:Shiga toxin subunit B host organism:Mus musculus C57BL/6

    Publication: 3286503;

  83. Synthetic peptides of Shiga toxin B subunit induce antibodies which neutralize its biological activity.

    ID: 1485005

    Description: epitope description:GKVEYTKYNDDDTFTVKVGD antigen name:Shiga toxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3286503;

  84. Molecular analysis of neutralizing epitopes on outer surface proteins A and B of Borrelia burgdorferi.

    ID: 1485008

    Description: epitope description:QYDSNGTKLE antigen name:Outer surface protein A host organism:Mus musculus BALB/c antibody name:B3G11

    Publication: 7539408;

  85. Molecular analysis of neutralizing epitopes on outer surface proteins A and B of Borrelia burgdorferi.

    ID: 1485010

    Description: epitope description:TLKREIEKDG antigen name:Outer surface protein B host organism:Mus musculus BALB/c antibody name:N5G5

    Publication: 7539408;

  86. Synthetic peptides of Shiga toxin B subunit induce antibodies which neutralize its biological activity.

    ID: 1485016

    Description: epitope description:KYNDDDTFTVKVGD antigen name:Shiga toxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3286503;

  87. Molecular analysis of neutralizing epitopes on outer surface proteins A and B of Borrelia burgdorferi.

    ID: 1485017

    Description: epitope description:TLKREIEKDG antigen name:Outer surface protein B host organism:Mus musculus BALB/c antibody name:N5G5

    Publication: 7539408;

  88. Antigenic variation among equine H 3 N 8 influenza virus hemagglutinins.

    ID: 1485045

    Description: epitope description:N231 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:M6/1

    Publication: 11276582;

  89. Lipopeptide immunization without adjuvant induces potent and long-lasting B, T helper, and cytotoxic T lymphocyte responses against a malaria liver st...

    ID: 1485050

    Description: epitope description:LEESQVNDDIFNSLVKSVQQEQQHNV antigen name:Liver stage antigen 3 host organism:Mus musculus C57BL/6 antibody name:Mouse sera

    Publication: 9174617;

  90. Lipopeptide immunization without adjuvant induces potent and long-lasting B, T helper, and cytotoxic T lymphocyte responses against a malaria liver st...

    ID: 1485052

    Description: epitope description:LEESQVNDDIFNSLVKSVQQEQQHNV antigen name:Liver stage antigen 3 host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 9174617;

  91. Lipopeptide immunization without adjuvant induces potent and long-lasting B, T helper, and cytotoxic T lymphocyte responses against a malaria liver st...

    ID: 1485053

    Description: epitope description:LEESQVNDDIFNSLVKSVQQEQQHNV antigen name:Liver stage antigen 3 host organism:Mus musculus DBA/1 antibody name:Mouse sera

    Publication: 9174617;

  92. Mapping of sequential epitopes recognized by monoclonal antibodies on the bovine leukaemia virus external glycoproteins expressed in Escherichia coli ...

    ID: 1485108

    Description: epitope description:PISLVNLSTASS antigen name:gp60 SU host organism:Mus musculus BALB/c antibody name:A

    Publication: 1383413;

  93. An epitope on the adenovirus fibre tail is common to all human subgroups.

    ID: 1485199

    Description: epitope description:FFNIAY host organism:Mus musculus BALB/c antibody name:Mab 21

    Publication: 10893158;

  94. An epitope on the adenovirus fibre tail is common to all human subgroups.

    ID: 1485200

    Description: epitope description:WYNVVY host organism:Mus musculus BALB/c antibody name:Mab 21

    Publication: 10893158;

  95. An epitope on the adenovirus fibre tail is common to all human subgroups.

    ID: 1485202

    Description: epitope description:TFNLAY host organism:Mus musculus BALB/c antibody name:Mab 21

    Publication: 10893158;

  96. An epitope on the adenovirus fibre tail is common to all human subgroups.

    ID: 1485207

    Description: epitope description:YFNPAY host organism:Mus musculus BALB/c antibody name:Mab 21

    Publication: 10893158;

  97. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1485267

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  98. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485357

    Description: epitope description:PQTTKPKEVLTT antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  99. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485359

    Description: epitope description:KEVLTTKPTEKP antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  100. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485372

    Description: epitope description:KETLHSTSPEGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston