Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464070

    Description: epitope description:TDSSSDSQTITN antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  2. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464084

    Description: epitope description:SHDLQLNDGTVKAICVAGSFKVT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  3. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464086

    Description: epitope description:SHDLQLNDGTVKAICVAGSFKVT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  4. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464096

    Description: epitope description:SLHKGALLTSVTFELLFDGTN antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  5. Mutational analysis of amino acid positions crucial for IgE-binding epitopes of the major apple (Malus domestica) allergen, Mal d 1.

    ID: 1464105

    Description: epitope description:T11, F31, S57, S113, I114 antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 16293967;

  6. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1464109

    Description: epitope description:SQWGWCGSTDEYCSPDHNCQ antigen name:Hev b 6 host organism:Mus musculus antibody name:1A5.4.3

    Publication: 15080815;

  7. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1464113

    Description: epitope description:SICGNNQLCKSICKT antigen name:Major surface glycoprotein G host organism:Mus musculus antibody name:8188, 8305, 9177, 26

    Publication: 1697913;

  8. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464115

    Description: epitope description:KKPNRQGLGYYSPSYNDP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  9. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464118

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  10. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464125

    Description: epitope description:APPSQPFPWTHCYQPRL antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  11. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464129

    Description: epitope description:AQYAAQNRRGLDLLFW antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  12. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464174

    Description: epitope description:NCKITKTPTAWKPNYAPANCPKS antigen name:UniProt:W5V4N0 host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;

  13. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464207

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:P288 (PAK) s...

    Publication: 15386623;

  14. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464210

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) ...

    Publication: 15386623;

  15. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464216

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) s...

    Publication: 15386623;

  16. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464221

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:P288 (PAK) s...

    Publication: 15386623;

  17. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464234

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) sera

    Publication: 15386623;

  18. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464244

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) sera

    Publication: 15386623;

  19. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464245

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P se...

    Publication: 15386623;

  20. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464246

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston