Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Superiority of thyroid peroxidase DNA over protein immunization in replicating human thyroid autoimmunity in HLA-DRB1*0301 (DR3) transgenic mice.

    ID: 1709695

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

    Publication: 15320899;

  2. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709798

    Description: epitope description:DLSTAIASRSVADKILDLY antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  3. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709799

    Description: epitope description:PRGWNPGFLYNGFPL antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  4. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709801

    Description: epitope description:RWLPPVYEDGFS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  5. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709808

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  6. Immunogenicity of a unique region of the human thyrotropin receptor.

    ID: 1709825

    Description: epitope description:YYVFFEEQEDEIIGFG antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7901266;

  7. Immunogenicity of a unique region of the human thyrotropin receptor.

    ID: 1709826

    Description: epitope description:TLQAFDSHYDYTICGDNEDMV antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7901266;

  8. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709967

    Description: epitope description:RDYIPRILGPEAFQQYVGP antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  9. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709970

    Description: epitope description:PGLWLHQAFFSPWTLLR antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  10. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709972

    Description: epitope description:VADKILDLYKHPDNIDVWL antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  11. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709977

    Description: epitope description:TDAQRRELEKHSLSRVIC antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  12. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709981

    Description: epitope description:GPYEGYDSTA antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  13. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709988

    Description: epitope description:EAFQQYVGPYEGYDST antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  14. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709989

    Description: epitope description:EAFQQYVGPYEGYDST antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  15. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709992

    Description: epitope description:NFLPRARTG antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  16. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709995

    Description: epitope description:TRVPMDAFQVGKFPEDFESC antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  17. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709996

    Description: epitope description:RLDASFQEHPDLPG antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  18. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709999

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  19. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1710001

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  20. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1710008

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

    Publication: 15030525;

  21. Antisera to synthetic peptides of lens MIP26K (major intrinsic polypeptide): characterization and use as site-specific probes of membrane changes in t...

    ID: 1710019

    Description: epitope description:TGEPVELK antigen name:Lens fiber major intrinsic protein host organism:Oryctolagus cuniculus

    Publication: 2415383;

  22. Analysis of B cell epitopes of a glycoprotein porcine zona pellucida (pZP1).

    ID: 1710028

    Description: epitope description:LDPENLTL antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus BALB/c antibody name:5H4

    Publication: 10924748;

  23. Analysis of B cell epitopes of a glycoprotein porcine zona pellucida (pZP1).

    ID: 1710030

    Description: epitope description:LDPENLTL antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus BALB/c antibody name:5H4

    Publication: 10924748;

  24. High plasma concentrations of autoantibodies against native peptide 210 of apoB-100 are related to less coronary atherosclerosis and lower risk of myo...

    ID: 1710154

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens

    Publication: 18664466;

  25. High plasma concentrations of autoantibodies against native peptide 210 of apoB-100 are related to less coronary atherosclerosis and lower risk of myo...

    ID: 1710156

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens

    Publication: 18664466;

  26. High plasma concentrations of autoantibodies against native peptide 210 of apoB-100 are related to less coronary atherosclerosis and lower risk of myo...

    ID: 1710161

    Description: epitope description:KTTKQSFDLSVKAQYKKNKH antigen name:Apolipoprotein B-100 host organism:Homo sapiens

    Publication: 18664466;

  27. Flow cytometric analyses of antibody binding to Chinese hamster ovary cells expressing human thyrotropin receptor.

    ID: 1710166

    Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9177401;

  28. Impact of feline zona pellucida glycoprotein B-derived synthetic peptides on in vitro fertilization of cat oocytes.

    ID: 1710447

    Description: epitope description:VEGTDAAGRRVTNTKVLRCP antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus

    Publication: 15056783;

  29. Interaction of BP180 (type XVII collagen) and alpha6 integrin is necessary for stabilization of hemidesmosome structure.

    ID: 1710573

    Description: epitope description:RSILPYGDSMDRIE antigen name:Collagen alpha-1(XVII) chain host organism:Oryctolagus cuniculus

    Publication: 9856810;

  30. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710574

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Rattus norvegicus Wistar

    Publication: 11028906;

  31. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710575

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Rattus norvegicus Wistar

    Publication: 11028906;

  32. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710577

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Rattus norvegicus Wistar

    Publication: 11028906;

  33. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710578

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Oryctolagus cuniculus albino

    Publication: 11028906;

  34. A zona pellucida 3 peptide vaccine induces antibodies and reversible infertility without ovarian pathology.

    ID: 1710607

    Description: epitope description:NSSSSQFQIHGPR antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus A/J

    Publication: 7650399;

  35. Rabbit antibodies toward extracellular loops of the membrane spanning region of human thyrotropin receptor possess thyroid stimulating activities.

    ID: 1710611

    Description: epitope description:HSEYYNHAIDWQTGPGCNTA antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus antibody name:anti-E1

    Publication: 1764054;

  36. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710619

    Description: epitope description:YYVFFEEQEDEIIGF antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  37. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710620

    Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  38. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710622

    Description: epitope description:PQEETLQAFDSHYDYT antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  39. Sera of children with hepatitis C infection and anti-liver-kidney microsome-1 antibodies recognize different CYP2D6 epitopes than adults with LKM+/HCV...

    ID: 1710653

    Description: epitope description:LLTEHRMTWDPAQPPRDL antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10554122;

  40. Sera of children with hepatitis C infection and anti-liver-kidney microsome-1 antibodies recognize different CYP2D6 epitopes than adults with LKM+/HCV...

    ID: 1710656

    Description: epitope description:EKPFRFHPEHFLDAQGHFVK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10554122;

  41. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710666

    Description: epitope description:TLQAFDSHYDYTICGDSKDMV antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  42. Efficacy of antibodies against a chimeric synthetic peptide encompassing epitopes of bonnet monkey (Macaca radiata) zona pellucida-1 and zona pellucid...

    ID: 1710673

    Description: epitope description:DRAVYENELVATRDVKNGSRGSV antigen name:Glycoprotein zona pellucida-1 host organism:Macaca radiata

    Publication: 15625695;

  43. Efficacy of antibodies against a chimeric synthetic peptide encompassing epitopes of bonnet monkey (Macaca radiata) zona pellucida-1 and zona pellucid...

    ID: 1710700

    Description: epitope description:DRAVYENELVATRDVKNGSRGSVGGGKGDCGTPSHSRRQPHVVSQWSRSA host organism:Mus musculus BALB/c

    Publication: 15625695;

  44. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710703

    Description: epitope description:SERVQLLHSQNTSLINQK antigen name:Myosin-7 host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  45. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710706

    Description: epitope description:KEALISSLTRGKLTYTQQ antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  46. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710720

    Description: epitope description:SERVQLLHSQNTSLINQK antigen name:Myosin-7 host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  47. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710721

    Description: epitope description:NKNLQEEISDLTEQLGSS antigen name:Myosin-7 host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  48. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1710724

    Description: epitope description:AETIFD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 7690812;

  49. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1710727

    Description: epitope description:TIFDVT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B10.BR

    Publication: 7690812;

  50. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710733

    Description: epitope description:KEALISSLTRGKLTYTQQ antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston