Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Localization of epitopes for monoclonal antibodies at the N-terminus of the porcine zona pellucida glycoprotein pZPC.

    ID: 1711292

    Description: epitope description:VWQDE antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus BALB/c antibody name:455

    Publication: 8562067;

  2. Localization of epitopes for monoclonal antibodies at the N-terminus of the porcine zona pellucida glycoprotein pZPC.

    ID: 1711298

    Description: epitope description:WQDE antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus BALB/c antibody name:467

    Publication: 8562067;

  3. High-avidity human serum antibodies recognizing linear epitopes of Borna disease virus proteins.

    ID: 1711327

    Description: epitope description:ENPTMAGYR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 12062882;

  4. High-avidity human serum antibodies recognizing linear epitopes of Borna disease virus proteins.

    ID: 1711336

    Description: epitope description:VPRESY antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 12062882;

  5. Overlapping but distinct specificities of anti-liver-kidney microsome antibodies in autoimmune hepatitis type II and hepatitis C revealed by recombina...

    ID: 1711352

    Description: epitope description:EHRMTWDPAQPPR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10540193;

  6. Overlapping but distinct specificities of anti-liver-kidney microsome antibodies in autoimmune hepatitis type II and hepatitis C revealed by recombina...

    ID: 1711353

    Description: epitope description:DLTEAFLAEMEKAKGNPESSFNDEN antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10540193;

  7. Overlapping but distinct specificities of anti-liver-kidney microsome antibodies in autoimmune hepatitis type II and hepatitis C revealed by recombina...

    ID: 1711356

    Description: epitope description:NDENLRIVVADLFSAGMVTT antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10540193;

  8. Overlapping but distinct specificities of anti-liver-kidney microsome antibodies in autoimmune hepatitis type II and hepatitis C revealed by recombina...

    ID: 1711361

    Description: epitope description:GMTHMTSRDIEVQGFRI antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10540193;

  9. Antibody responses against galactocerebroside are potential stage-specific biomarkers in multiple sclerosis.

    ID: 1711367

    Description: epitope description:galactosylceramide host organism:Callithrix jacchus antibody name:Marmoset sera

    Publication: 16083805;

  10. Study of the B cell response to cytochrome P450IID6 in sera from chronic hepatitis C patients.

    ID: 1711387

    Description: epitope description:GQVRRPEMGDQA antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 8918582;

  11. Identification and analysis of cytochrome P450IID6 antigenic sites recognized by anti-liver-kidney microsome type-1 antibodies (LKM1).

    ID: 1711405

    Description: epitope description:EHRMTWDPAQPPR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 7682958;

  12. Identification and analysis of cytochrome P450IID6 antigenic sites recognized by anti-liver-kidney microsome type-1 antibodies (LKM1).

    ID: 1711409

    Description: epitope description:TEAFLAEMEK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 7682958;

  13. Identification and analysis of cytochrome P450IID6 antigenic sites recognized by anti-liver-kidney microsome type-1 antibodies (LKM1).

    ID: 1711417

    Description: epitope description:MILHPDVQRRVQQEIDDVI antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 7682958;

  14. Identification and analysis of cytochrome P450IID6 antigenic sites recognized by anti-liver-kidney microsome type-1 antibodies (LKM1).

    ID: 1711418

    Description: epitope description:GQVRRPEMGDQA antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 7682958;

  15. Identification and analysis of cytochrome P450IID6 antigenic sites recognized by anti-liver-kidney microsome type-1 antibodies (LKM1).

    ID: 1711419

    Description: epitope description:EKPFRFHPEHFLDAQGHFVK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 7682958;

  16. High-resolution epitope mapping and fine antigenic characterization of the main immunogenic region of the acetylcholine receptor. Improving the bindin...

    ID: 1704172

    Description: epitope description:WNPDD antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Rattus norvegicus Lewis antibody name:mAb 6

    Publication: 7678806;

  17. Immunization with an immunodominant self-peptide derived from glucose-6-phosphate isomerase induces arthritis in DBA/1 mice.

    ID: 1704201

    Description: epitope description:IWYINCFGCETHAML antigen name:Glucose-6-phosphate isomerase (UniProt:P06744) host organism:Mus musculus DBA/1

    Publication: 19640302;

  18. High-resolution epitope mapping and fine antigenic characterization of the main immunogenic region of the acetylcholine receptor. Improving the bindin...

    ID: 1704209

    Description: epitope description:WNPADYGGIK antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus Lewis antibody name:MAbs 42, 28, 37, ...

    Publication: 7678806;

  19. High-resolution epitope mapping and fine antigenic characterization of the main immunogenic region of the acetylcholine receptor. Improving the bindin...

    ID: 1704210

    Description: epitope description:WNPADYGGIK antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus Lewis antibody name:mAb 203

    Publication: 7678806;

  20. High-resolution epitope mapping and fine antigenic characterization of the main immunogenic region of the acetylcholine receptor. Improving the bindin...

    ID: 1704223

    Description: epitope description:WNPDDYGGVK antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Rattus norvegicus Lewis antibody name:...

    Publication: 7678806;

  21. Mapping of a cholinergic binding site by means of synthetic peptides, monoclonal antibodies, and alpha-bungarotoxin.

    ID: 1704515

    Description: epitope description:SISPESDRPDLSTFMESGEW antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus BALB/c antibody name:WF6

    Publication: 2207067;

  22. Mapping of a cholinergic binding site by means of synthetic peptides, monoclonal antibodies, and alpha-bungarotoxin.

    ID: 1704520

    Description: epitope description:ITVGLQLIQLISVDEVNQIV antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus BALB/c antibody name:WF5

    Publication: 2207067;

  23. Location of antigenic determinants on primary sequences of subunits of nicotinic acetylcholine receptor by peptide mapping.

    ID: 1704525

    Description: epitope description:VDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVE antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus Lewis ant...

    Publication: 2424498;

  24. Location of antigenic determinants on primary sequences of subunits of nicotinic acetylcholine receptor by peptide mapping.

    ID: 1704526

    Description: epitope description:VTTPSPDSKPTIISRANDEYFIRKPAGDFVCPVDNAR antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus Lewis antib...

    Publication: 2424498;

  25. Beta 2-adrenergic receptor antibodies in myasthenia gravis.

    ID: 1704529

    Description: epitope description:HWYRATHQEAINCYANETCCDFFTNQ antigen name:Beta-2 adrenergic receptor host organism:Homo sapiens

    Publication: 1378277;

  26. An octavalent lyme disease vaccine induces antibodies that recognize all incorporated OspC type-specific sequences.

    ID: 1704577

    Description: epitope description:PVVAESPKKP antigen name:UniProt:C0R9U8 host organism:Mus musculus C3H/He

    Publication: 17921702;

  27. Application of a chimeric synthetic peptide in the development of a serologic method for the diagnosis of hepatitis G virus infection.

    ID: 1704579

    Description: epitope description:EPGLTWQSCSCRANG antigen name:Pegivirus C protein host organism:Homo sapiens

    Publication: 18045227;

  28. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704657

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  29. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704658

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  30. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704663

    Description: epitope description:NNIMFKLDGCRDTHRYIWI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  31. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704669

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  32. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704672

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  33. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704675

    Description: epitope description:QVVVMKSKNDQGITNKCKM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  34. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704679

    Description: epitope description:SRTLGCSWEFIPVDDGWGERPL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9246568;

  35. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704684

    Description: epitope description:KNQIQLFNLESSKIEVILK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  36. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704685

    Description: epitope description:EVILKNAIVYNSMYENFST antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  37. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704692

    Description: epitope description:RLNNSKIYINGRLIDQKPI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  38. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704693

    Description: epitope description:DQKPISNLGNIHASNNIMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  39. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704695

    Description: epitope description:RYIWIKYFNLFDKELNEKE antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  40. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704703

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  41. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704705

    Description: epitope description:ILSALEIPDVGNLSQVVVM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  42. Localization of the regions on the C-terminal domain of the heavy chain of botulinum A recognized by T lymphocytes and by antibodies after immunizatio...

    ID: 1704710

    Description: epitope description:SRTLGCSWEFIPVDDGWGERPL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9246568;

  43. Monoclonal antibodies against the acetylcholine receptor gamma-subunit as site specific probes for receptor tyrosine phosphorylation.

    ID: 1704715

    Description: epitope description:TSDIDI antigen name:Acetylcholine receptor subunit gamma host organism:Rattus norvegicus Lewis antibody name:145

    Publication: 7537227;

  44. Epitope mapping of monoclonal antibodies to Torpedo acetylcholine receptor gamma subunits, which specifically recognize the epsilon subunit of mammali...

    ID: 1704727

    Description: epitope description:ELMFEEQKDRHGLKRVNKMT antigen name:Acetylcholine receptor subunit gamma host organism:Rattus norvegicus Lewis antibody name:7

    Publication: 1370956;

  45. Detection of antibodies directed against the cytoplasmic region of the human acetylcholine receptor in sera from myasthenia gravis patients.

    ID: 1704729

    Description: epitope description:KSAIEGVK antigen name:Acetylcholine receptor subunit alpha host organism:Homo sapiens

    Publication: 10209519;

  46. Analysis of specificity of antibodies against synthetic fragments of different neuronal nicotinic acetylcholine receptor subunits.

    ID: 1704739

    Description: epitope description:DFAVTHLTKAHLFYDGRV antigen name:Neuronal acetylcholine receptor subunit alpha-4 host organism:Oryctolagus cuniculus

    Publication: 16903829;

  47. Differential responses to Smith D autoantigen by mice with HLA-DR and HLA-DQ transgenes: dominant responses by HLA-DR3 transgenic mice with diversific...

    ID: 1704743

    Description: epitope description:LMKLSHETVTIELKN antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus HLA-DR3 Tg

    Publication: 20007529;

  48. Differential responses to Smith D autoantigen by mice with HLA-DR and HLA-DQ transgenes: dominant responses by HLA-DR3 transgenic mice with diversific...

    ID: 1704744

    Description: epitope description:LSHETVTIELKNGTQ antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus HLA-DR3 Tg

    Publication: 20007529;

  49. Differential responses to Smith D autoantigen by mice with HLA-DR and HLA-DQ transgenes: dominant responses by HLA-DR3 transgenic mice with diversific...

    ID: 1704747

    Description: epitope description:LKNGTQVHGTITGVD antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus HLA-DR3 Tg

    Publication: 20007529;

  50. Differential responses to Smith D autoantigen by mice with HLA-DR and HLA-DQ transgenes: dominant responses by HLA-DR3 transgenic mice with diversific...

    ID: 1704749

    Description: epitope description:VHGTITGVDVSMNTH antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus HLA-DR3 Tg

    Publication: 20007529;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston