Discrimination of hepatitis B virus (HBV) subtypes using monoclonal antibodies to the PreS1 and PreS2 domains of the viral envelope.

ID: 1382732

Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:50-80, 116-183, 55-...

Discrimination of hepatitis B virus (HBV) subtypes using monoclonal antibodies to the PreS1 and PreS2 domains of the viral envelope.

ID: 1382794

Description: epitope description:TVNPVLTTASPLSSIFSRIGDPALN antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:128-603

Liposome-entrapped T-cell peptide provides help for a co-entrapped B-cell peptide to overcome genetic restriction in mice and induce immunological mem...

ID: 1382990

Description: epitope description:NLSVPNPLGFLPDHQLDPAFGANSTNPWDFNPC antigen name:Large envelope protein host organism:Mus musculus SJL

Differential host-dependent expression of alpha-galactosyl epitopes on viral glycoproteins: a study of eastern equine encephalitis virus as a model.

ID: 1383000

Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group antigen name:N-glycan host organism:Homo sapiens

Epitope mapping of a single repetitive unit of the B13 Trypanosoma cruzi antigen as fusions to Escherichia coli LamB protein.

ID: 1409464

Description: epitope description:FGQAAAGDKPSP antigen name:Surface antigen 2 (CA-2), putative host organism:Oryctolagus cuniculus New Zealand White antibody name:R...