Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708449

    Description: epitope description:KCFTELFVKEPPVLIVTPLEDQQVFVGDRV antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  2. Mapping the extracellular topography of the alpha-chain in free and in membrane-bound acetylcholine receptor by antibodies against overlapping peptide...

    ID: 1708450

    Description: epitope description:EVNQIVETNVRLRQQW antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus ICR

    Publication: 8011070;

  3. Mapping the extracellular topography of the alpha-chain in free and in membrane-bound acetylcholine receptor by antibodies against overlapping peptide...

    ID: 1708452

    Description: epitope description:EVNQIVETNVRLRQQW antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus ICR

    Publication: 8011070;

  4. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708467

    Description: epitope description:TIFDVT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B10.A

    Publication: 7690812;

  5. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708478

    Description: epitope description:VGDRVEMAVEVSEEGAQVMWMKDGVELTRE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  6. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708491

    Description: epitope description:LIVEEKQLEVLQDIADLTVKASEQAVFKC antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  7. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708499

    Description: epitope description:DEGDYTFVPDGYALGSLSAKLNFLEIKVE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  8. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708503

    Description: epitope description:EIKVEYVPKQEPPKIHLDCSGKTSENAIV antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  9. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708505

    Description: epitope description:ENAIVVVAGNKLRLDVSITGE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  10. Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

    ID: 1708506

    Description: epitope description:ENAIVVVAGNKLRLDVSITGE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

    Publication: 17900708;

  11. Main immunogenic region of Torpedo electroplax and human muscle acetylcholine receptor: localization and microheterogeneity revealed by the use of syn...

    ID: 1708512

    Description: epitope description:SAIEGVKYIAEHMKSDEESSN antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus Lewis antibody name:153, 1...

    Publication: 1688377;

  12. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708558

    Description: epitope description:NPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  13. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708567

    Description: epitope description:AGLQND host organism:Mus musculus C57BL/10

    Publication: 7690812;

  14. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708576

    Description: epitope description:IAQPKS antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  15. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708577

    Description: epitope description:IAQPKS antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  16. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708582

    Description: epitope description:PKSAET antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  17. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708583

    Description: epitope description:KSAETI antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  18. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708586

    Description: epitope description:ETIFDV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  19. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708588

    Description: epitope description:IFDVTT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  20. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708596

    Description: epitope description:PTIAGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7690812;

  21. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708605

    Description: epitope description:QNDPTT host organism:Mus musculus C57BL/10

    Publication: 7690812;

  22. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1708610

    Description: epitope description:TNVARP host organism:Mus musculus C57BL/10

    Publication: 7690812;

  23. Epitope discovery using bacteriophage display: the minimum epitope of an anti-IRBP antibody.

    ID: 1708611

    Description: epitope description:ERVTRLEWPKNDPRI host organism:Mus musculus antibody name:H3B5

    Publication: 10375431;

  24. Epitope discovery using bacteriophage display: the minimum epitope of an anti-IRBP antibody.

    ID: 1708627

    Description: epitope description:QVIKMDLPQYEPRLA host organism:Mus musculus antibody name:H3B5

    Publication: 10375431;

  25. Mapping of a functional autoimmune epitope on the beta 1-adrenergic receptor in patients with idiopathic dilated cardiomyopathy.

    ID: 1708639

    Description: epitope description:HWWRAESDEARRCYNDPKCCDFVTNR antigen name:Beta-1 adrenergic receptor host organism:Oryctolagus cuniculus

    Publication: 1700798;

  26. Immune responses to peptides derived from the retinal protein IRBP: immunopathogenic determinants are not necessarily immunodominant.

    ID: 1708683

    Description: epitope description:AALTRAQEMLQHT antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis

    Publication: 2477180;

  27. Immune responses to peptides derived from the retinal protein IRBP: immunopathogenic determinants are not necessarily immunodominant.

    ID: 1708689

    Description: epitope description:PTARSVGAADGSSWEGVGVV antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis

    Publication: 2477180;

  28. Autoreactive IgG elicited in mice by the non-dominant but pathogenic thyroglobulin peptide (2495-2511): implications for thyroid autoimmunity.

    ID: 1708720

    Description: epitope description:GLINRAKAVKQFEESQG antigen name:Thyroglobulin host organism:Mus musculus B10.BR

    Publication: 7523008;

  29. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708857

    Description: epitope description:LEPETGKDMSPYEAYKRGII antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  30. Vaccination with a synthetic zona pellucida peptide produces long-term contraception in female mice.

    ID: 1708868

    Description: epitope description:CSNSSSSQFQIHGPRQ antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus Swiss

    Publication: 2479101;

  31. Periodate-resistant carbohydrate epitopes recognized by IgG and IgE antibodies from some of the immunized mice and patients with allergy.

    ID: 1708876

    Description: epitope description:alpha-D-Man-(1->6)-[alpha-D-Man-(1->3)]-[beta-D-Xyl-(1->2)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-Glc...

    Publication: 19285013;

  32. Periodate-resistant carbohydrate epitopes recognized by IgG and IgE antibodies from some of the immunized mice and patients with allergy.

    ID: 1708878

    Description: epitope description:3-O-{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-2,6-bis-O-{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-beta...

    Publication: 19285013;

  33. Periodate-resistant carbohydrate epitopes recognized by IgG and IgE antibodies from some of the immunized mice and patients with allergy.

    ID: 1708880

    Description: epitope description:3-O-{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-2,6-bis-O-{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-beta...

    Publication: 19285013;

  34. The x-ray structure of an anti-tumour antibody in complex with antigen.

    ID: 1708884

    Description: epitope description:methyl 8-{[alpha-L-fucopyranosyl-(1->3)-[alpha-L-fucopyranosyl-(1->2)-beta-D-galactopyranosyl-(1->4)]-2-acetamido-2-deoxy-beta-D-g...

    Publication: 7664109;

  35. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708890

    Description: epitope description:DMSPYEAYKRGIIDRGQYLQ antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  36. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708891

    Description: epitope description:YKRGIIDRGQYLQLQELECD antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  37. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708896

    Description: epitope description:RGQYLQLQELECDWEEVTTS antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  38. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708897

    Description: epitope description:RGQYLQLQELECDWEEVTTS antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  39. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708900

    Description: epitope description:QELECDWEEVTTSGPCGEES antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  40. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708901

    Description: epitope description:QELECDWEEVTTSGPCGEES antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  41. Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

    ID: 1708902

    Description: epitope description:QELECDWEEVTTSGPCGEES antigen name:Envoplakin host organism:Homo sapiens

    Publication: 16470171;

  42. The tyrosine phosphorylation site of the acetylcholine receptor beta subunit is located in a highly immunogenic epitope implicated in channel function...

    ID: 1708906

    Description: epitope description:PSPDSKPT antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus Lewis antibody name:10

    Publication: 7505221;

  43. Minimal motif mapping of a known epitope on human zona pellucida protein-4 using a peptide biosynthesis strategy.

    ID: 1708910

    Description: epitope description:PETQPGPLTLELQIAKDK antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19539378;

  44. The tyrosine phosphorylation site of the acetylcholine receptor beta subunit is located in a highly immunogenic epitope implicated in channel function...

    ID: 1708912

    Description: epitope description:DSKPTIISRAN antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus LOU antibody name:117

    Publication: 7505221;

  45. The tyrosine phosphorylation site of the acetylcholine receptor beta subunit is located in a highly immunogenic epitope implicated in channel function...

    ID: 1708913

    Description: epitope description:IKYIAEQLES antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus LOU antibody name:125

    Publication: 7505221;

  46. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1708954

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  47. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1708963

    Description: epitope description:PPPGMRPGPPP antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeal...

    Publication: 18849143;

  48. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1708964

    Description: epitope description:TRPNHTIY antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  49. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1708971

    Description: epitope description:VQGPVPGM antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  50. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1708972

    Description: epitope description:MTQAPRIMH antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston