MUC1 mucin-mediated regulation of human T cells.
ID: 18325
Description: epitope description:APDTR antigen name:Mucin-1 host organism:Mus musculus CBA X BALB/c antibody name:BC3 anti-MUC1 Ab
Publication: 15710907;ID: 18338
Description: epitope description:KTQIDQVESTAGSLQ antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum
Publication: 15155617;MUC1 mucin-mediated regulation of human T cells.
ID: 18339
Description: epitope description:APDTRP antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:SM3 anti-MUC1 Ab
Publication: 15710907;ID: 18357
Description: epitope description:AAGTAAQAAVVRFQE antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum
Publication: 15155617;ID: 18371
Description: epitope description:VRFQEAANKQKQELD antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum
Publication: 15155617;ID: 18379
Description: epitope description:KQELDEISTNIRQAG antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum
Publication: 15155617;ID: 18389
Description: epitope description:VQYSRADEEQQQALS antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum
Publication: 15155617;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16404
Description: epitope description:YIIGSTELGLISI antigen name:Andes orthohantavirus protein host organism:Homo sapiens
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16410
Description: epitope description:KLESSCNFDLHTT antigen name:Andes orthohantavirus protein host organism:Homo sapiens
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16412
Description: epitope description:FDLHTTSMAQKSFTQVEWRKKSDTTDTTNAASTTFEAQT antigen name:Andes orthohantavirus protein host organism:Homo sapiens
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16418
Description: epitope description:LCYDLTCNQTHCQ antigen name:Andes orthohantavirus protein host organism:Homo sapiens
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16419
Description: epitope description:LCYDLTCNQTHCQ antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16425
Description: epitope description:SIRSCMARVFTSR antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16427
Description: epitope description:ARVFTSRIQVIYE antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16429
Description: epitope description:IQVIYEKTHCVTG antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16435
Description: epitope description:CFNPAHTLTLSQP antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16440
Description: epitope description:TLPISCFFTPKES antigen name:Andes orthohantavirus protein host organism:Homo sapiens
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16443
Description: epitope description:FFTPKESEQLKVIKTFEGIL antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16444
Description: epitope description:KTFEGILTKTGCT antigen name:Andes orthohantavirus protein host organism:Homo sapiens
Publication: 15780882;Human and rodent humoral immune responses to Andes virus structural proteins.
ID: 16449
Description: epitope description:ENALQGYYVCFLG antigen name:Andes orthohantavirus protein host organism:Mus musculus
Publication: 15780882;