Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409671

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-H37Rv

    Publication: 3744551;

  2. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409674

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-M. fortuitum

    Publication: 3744551;

  3. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409695

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/6

    Publication: 10225836;

  4. How reliable is the structural prediction of IgE-binding epitopes of allergens? The case study of plant lipid transfer proteins.

    ID: 1409704

    Description: epitope description:RTTPDRQAA antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 17059861;

  5. How reliable is the structural prediction of IgE-binding epitopes of allergens? The case study of plant lipid transfer proteins.

    ID: 1409706

    Description: epitope description:RTTPDRQAA antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 17059861;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston