Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485374

    Description: epitope description:TSPEGNPSPSQV antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  2. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485376

    Description: epitope description:PSPSQVYTTSEY antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  3. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485379

    Description: epitope description:SEYPSQPPSPSN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  4. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485380

    Description: epitope description:PSQPPSPSNTTN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  5. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485381

    Description: epitope description:SQPTSPSNITNQ antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  6. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485382

    Description: epitope description:DHKPQTTKPKEA antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  7. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485385

    Description: epitope description:KEAPTTKPTEKP antigen name:Attachment glycoprotein (G) host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  8. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485392

    Description: epitope description:RTTLLTNSTTGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  9. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485393

    Description: epitope description:LLTNSTTGNLEH antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  10. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485436

    Description: epitope description:EETLHSTSSEGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  11. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485438

    Description: epitope description:YTTSEYPSQPPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  12. Bacterially expressed antigenic peptide from foot-and-mouth disease virus capsid elicits variable immunologic responses in animals.

    ID: 1485479

    Description: epitope description:PNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus CBA

    Publication: 3005401;

  13. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485491

    Description: epitope description:NSTTGNLEH antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  14. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485496

    Description: epitope description:SNTTRNPEL antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  15. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485503

    Description: epitope description:NSTTGNLEL antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  16. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485504

    Description: epitope description:NNTTGNPEH antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  17. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485507

    Description: epitope description:NNTTGYLEL antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  18. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485511

    Description: epitope description:LHSTSSEGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  19. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485522

    Description: epitope description:SEYQSQPPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  20. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485524

    Description: epitope description:SEYLSQPPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  21. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485525

    Description: epitope description:SEYLSQPTS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  22. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485528

    Description: epitope description:SEYLSQTPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  23. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485529

    Description: epitope description:SEYLSQPLS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  24. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485533

    Description: epitope description:FEYLSQSPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  25. Bacterially expressed antigenic peptide from foot-and-mouth disease virus capsid elicits variable immunologic responses in animals.

    ID: 1485534

    Description: epitope description:PNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus A/J

    Publication: 3005401;

  26. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485535

    Description: epitope description:FHSTSSESN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  27. Production and characteristics of strain common antibodies against a synthetic polypeptide corresponding to the C-terminal region of potato virus Y co...

    ID: 1485540

    Description: epitope description:HTTEDVSPSMHTLLGVKNM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1474133;

  28. Structural comparison between retro-inverso and parent peptides: molecular basis for the biological activity of a retro-inverso analogue of the immuno...

    ID: 1485549

    Description: epitope description:GSGVRGDSGSLALRVARQL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 9095678;

  29. Structural comparison between retro-inverso and parent peptides: molecular basis for the biological activity of a retro-inverso analogue of the immuno...

    ID: 1485550

    Description: epitope description:GSGVRGDSGSLALRVARQL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 9095678;

  30. Epitope mapping by cysteine mutagenesis: identification of residues involved in recognition by three monoclonal antibodies directed against LamB glyco...

    ID: 1485555

    Description: epitope description:T336, D379, G382, D385, N387, N389, K392, F398 antigen name:Maltoporin host organism:Mus musculus BALB/c antibody name:302

    Publication: 7521310;

  31. Human T-lymphotropic virus type 1 peptides in chimeric and multivalent constructs with promiscuous T-cell epitopes enhance immunogenicity and overcome...

    ID: 1485573

    Description: epitope description:PHWTKKPNRNGGGYYSASYSDP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7545241;

  32. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485848

    Description: epitope description:DVAGLEKDPVA host organism:Mus musculus antibody name:A-20

    Publication: 2453883;

  33. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485850

    Description: epitope description:DVAGLEKDPVA host organism:Mus musculus antibody name:A-20

    Publication: 2453883;

  34. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485853

    Description: epitope description:DNENHATVSDSKLV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-45

    Publication: 2453883;

  35. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485858

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-5

    Publication: 2453883;

  36. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485859

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-5

    Publication: 2453883;

  37. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485860

    Description: epitope description:FDVTTLNPTIAGAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:DIII-A3

    Publication: 2453883;

  38. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485861

    Description: epitope description:FDVTTLNPTIAGAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:DIII-A3

    Publication: 2453883;

  39. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485862

    Description: epitope description:FDVTTLNPTIAGAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:DIII-A3

    Publication: 2453883;

  40. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485864

    Description: epitope description:SATTVFDVTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-10

    Publication: 2453883;

  41. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485865

    Description: epitope description:SATTVFDVTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-10

    Publication: 2453883;

  42. Development of human antibodies against linear antigenic and immunogenic regions of respiratory syncytial virus (RSV) nucleocapsid and phospho-protein...

    ID: 1485883

    Description: epitope description:EKLNNLLEGNDSDNDLSLEDF antigen name:Phosphoprotein host organism:Homo sapiens antibody name:Paired Human Sera

    Publication: 9785215;

  43. Synthetic immunogens constructed from T-cell and B-cell stimulating peptides (T:B chimeras): preferential stimulation of unique T- and B-cell specific...

    ID: 1485998

    Description: epitope description:CEYNVFHNKTFELPRA antigen name:Small hydrophobic protein (SH) host organism:Mus musculus SJL

    Publication: 1688404;

  44. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486159

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  45. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486160

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  46. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486161

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  47. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486183

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  48. Identification of mimotopes of the Japanese encephalitis virus envelope protein using phage-displayed combinatorial peptide library.

    ID: 1486188

    Description: epitope description:TQHPENQPQQRV host organism:Mus musculus BALB/c antibody name:mAb 2H2

    Publication: 15741739;

  49. Identification of mimotopes of the Japanese encephalitis virus envelope protein using phage-displayed combinatorial peptide library.

    ID: 1486224

    Description: epitope description:INIDSNPLHHLL host organism:Mus musculus BALB/c antibody name:mAb 2H2

    Publication: 15741739;

  50. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486232

    Description: epitope description:R764, D838 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  51. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486233

    Description: epitope description:R764, D838 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  52. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486235

    Description: epitope description:R764, T827 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  53. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486252

    Description: epitope description:R764 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB115c

    Publication: 1381537;

  54. Production and characteristics of strain common antibodies against a synthetic polypeptide corresponding to the C-terminal region of potato virus Y co...

    ID: 1486254

    Description: epitope description:HTTEDVSPSMHTLLGVKNM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1474133;

  55. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1486423

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  56. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1486426

    Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  57. Virus-specific CTL responses induced by an H-2K(d)-restricted, motif-negative 15-mer peptide from the fusion protein of respiratory syncytial virus.

    ID: 1486434

    Description: epitope description:ELQLLMQSTPPTNNR antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11807236;

  58. Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

    ID: 1486468

    Description: epitope description:S23 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.30, 1.44

    Publication: 7522372;

  59. Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

    ID: 1486492

    Description: epitope description:YGPGVDY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.29

    Publication: 7522372;

  60. Identification of a T-cell epitope adjacent to neutralization antigenic site 1 of poliovirus type 1.

    ID: 1486527

    Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1702841;

  61. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486538

    Description: epitope description:KNTTTTQTQPSK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  62. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486542

    Description: epitope description:TTQTQPSKPTTK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  63. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486560

    Description: epitope description:PPNKPNNDFHFE antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  64. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486566

    Description: epitope description:NDFHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  65. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486567

    Description: epitope description:DFHFEVFNFVPC antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  66. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486568

    Description: epitope description:FHFEVFNFVPCS antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  67. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486573

    Description: epitope description:FEVFNFVPCSIC antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  68. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486583

    Description: epitope description:NKKPGKKTTTKP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  69. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486586

    Description: epitope description:PGKKTTTKPTKK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  70. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486591

    Description: epitope description:TTKPTKKPTFKT antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  71. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486592

    Description: epitope description:TKPTKKPTFKTT antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  72. Epitope mapping of monoclonal antibodies to Escherichia coli ribosomal protein S3.

    ID: 1486593

    Description: epitope description:AAVEQPEKPAAQPKKQQRKGRK antigen name:30S ribosomal protein S3 host organism:Mus musculus BALB/c antibody name:392F10G8, 382D8G1B4, ...

    Publication: 1696825;

  73. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486610

    Description: epitope description:DHKPQTTKPKEV antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  74. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486611

    Description: epitope description:HKPQTTKPKEVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  75. Antigenicity modulation upon peptide cyclization: application to the GH loop of foot-and-mouth disease virus strain C1-Barcelona.

    ID: 1486631

    Description: epitope description:YTASARGDLAHLTTT antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

    Publication: 11348711;

  76. Antigenicity modulation upon peptide cyclization: application to the GH loop of foot-and-mouth disease virus strain C1-Barcelona.

    ID: 1486639

    Description: epitope description:YTTSTRGDLAHVTAT antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

    Publication: 11348711;

  77. Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

    ID: 1486648

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9228999;

  78. Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

    ID: 1486649

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9228999;

  79. Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

    ID: 1486653

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 9228999;

  80. Epitope analysis of an immunodominant domain on the P1 protein of Haemophilus influenzae type b using synthetic peptides and anti-idiotypic antibodies...

    ID: 1486676

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Mus musculus antibody name:P1.1, P1.6,...

    Publication: 1522798;

  81. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486732

    Description: epitope description:AHETSLNAAGNSVIHYTNIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D2

    Publication: 12029154;

  82. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486781

    Description: epitope description:NRQDFTQDPG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4F9, 4H1, 5G3

    Publication: 12029154;

  83. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486785

    Description: epitope description:KFTEPVKDIM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1E10, 2A11, 5A9

    Publication: 12029154;

  84. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486787

    Description: epitope description:KFTEPVKDIM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1E10, 2A11, 5A9

    Publication: 12029154;

  85. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486805

    Description: epitope description:KEGYAMDHEGCKFSC antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  86. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486814

    Description: epitope description:IRPSGYCGRECGIKK antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  87. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486816

    Description: epitope description:LPNWVKVWDRATNKC antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  88. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486820

    Description: epitope description:WNYDNAYCDKLCKDK antigen name:Toxin-5 host organism:Equus caballus

    Publication: 15970301;

  89. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483618

    Description: epitope description:PSDTMQTRHVKNYHSRSES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  90. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483838

    Description: epitope description:SSPCHNSLILPPFSLSPVPTLGSRS antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 9495252;

  91. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483841

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  92. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483842

    Description: epitope description:LNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  93. Intrathecal humoral immune response in HAM/TSP in relation to HLA haplotype analysis.

    ID: 1483873

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:Intrathecal

    Publication: 8937542;

  94. Minor displacements in the insertion site provoke major differences in the induction of antibody responses by chimeric parvovirus-like particles.

    ID: 1483886

    Description: epitope description:NPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 10544085;

  95. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483899

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus

    Publication: 11027638;

  96. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483901

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11027638;

  97. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483916

    Description: epitope description:(2E,4S)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:S412

    Publication: 16603628;

  98. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483927

    Description: epitope description:(2E,4R)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:R310

    Publication: 16603628;

  99. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483975

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;

  100. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483981

    Description: epitope description:TTCTASARGDLAHLTTTHACHL + CYSTL(C3, C20) host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston