Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483841

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  2. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483842

    Description: epitope description:LNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  3. Intrathecal humoral immune response in HAM/TSP in relation to HLA haplotype analysis.

    ID: 1483873

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:Intrathecal

    Publication: 8937542;

  4. Minor displacements in the insertion site provoke major differences in the induction of antibody responses by chimeric parvovirus-like particles.

    ID: 1483886

    Description: epitope description:NPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 10544085;

  5. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483899

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus

    Publication: 11027638;

  6. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483901

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11027638;

  7. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483916

    Description: epitope description:(2E,4S)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:S412

    Publication: 16603628;

  8. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483927

    Description: epitope description:(2E,4R)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:R310

    Publication: 16603628;

  9. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483975

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;

  10. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483981

    Description: epitope description:TTCTASARGDLAHLTTTHACHL + CYSTL(C3, C20) host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston