Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709379

    Description: epitope description:APGMRPPMGG antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  2. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709382

    Description: epitope description:PMGGHMPMMPGPPMMR antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  3. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709385

    Description: epitope description:PMMRPPARPM antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  4. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709393

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  5. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709397

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  6. Native zona pellucida reactivity and in-vitro effect on human sperm-egg binding with antisera against bonnet monkey ZP1 and ZP3 synthetic peptides.

    ID: 1709405

    Description: epitope description:WDNQGLLHKLQNDSDCGTWIRK antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c

    Publication: 12106885;

  7. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709407

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  8. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709409

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  9. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709414

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  10. Native zona pellucida reactivity and in-vitro effect on human sperm-egg binding with antisera against bonnet monkey ZP1 and ZP3 synthetic peptides.

    ID: 1709418

    Description: epitope description:SVRLALRNDSACNPVMA antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c

    Publication: 12106885;

  11. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709442

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18849143;

  12. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709447

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Mus musculus SJL

    Publication: 18849143;

  13. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709450

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Mus musculus SJL

    Publication: 18849143;

  14. Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

    ID: 1709451

    Description: epitope description:PPPGMRPP antigen name:Small nuclear ribonucleoprotein-associated protein N host organism:Mus musculus SJL

    Publication: 18849143;

  15. Native zona pellucida reactivity and in-vitro effect on human sperm-egg binding with antisera against bonnet monkey ZP1 and ZP3 synthetic peptides.

    ID: 1709454

    Description: epitope description:DRAVYENELVATRDVKNGSRGSV antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c

    Publication: 12106885;

  16. Identification of functional epitopes of Pseudomonas aeruginosa exotoxin A using synthetic peptides and subclone products.

    ID: 1709636

    Description: epitope description:LNAGNQLS antigen name:Exotoxin A host organism:Rattus norvegicus Sprague-Dawley

    Publication: 1700288;

  17. Lupus autoantibodies discriminate between the highly homologous Sm polypeptides B/B' and SmN by binding an epitope restricted to B/B'.

    ID: 1710252

    Description: epitope description:VGRATPPPGIMA antigen name:Small nuclear ribonucleoprotein-associated protein N host organism:Homo sapiens

    Publication: 7683587;

  18. The immunogenicity of recombinant and dimeric gonadotrophin-releasing hormone vaccines incorporating a T-helper epitope and GnRH or repeated GnRH unit...

    ID: 1710257

    Description: epitope description:EHWSYGLRPG antigen name:Other Mus musculus (mouse) protein host organism:Rattus norvegicus Sprague-Dawley

    Publication: 15251417;

  19. Inhibition of fertility in female mice by immunization with a B-cell epitope, the synthetic sperm peptide, P10G.

    ID: 1710272

    Description: epitope description:PGGGTLPPSG antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Mus musculus BALB/cByJ

    Publication: 7513024;

  20. A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

    ID: 1710371

    Description: epitope description:DLMHRRQRWAARYPPGPLPLPGLGNLLHVD antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 16327157;

  21. A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

    ID: 1710375

    Description: epitope description:RPPVPITQILGFGPRSQGVFLARYGPAWRE antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 16327157;

  22. A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

    ID: 1710376

    Description: epitope description:LARYGPAWREQRRFSVSTLRNLGLGKKSLE antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 16327157;

  23. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710383

    Description: epitope description:FETVEELSSPLTAHVTGRIPLWLTGSLLRCGP antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  24. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710385

    Description: epitope description:YHLFDGQALLHKFDFKEGHVTYHRRFIRTD antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  25. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710387

    Description: epitope description:KRIVITEFGTCAFPDPCKNIFSRFFSYFRG antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  26. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710392

    Description: epitope description:FGKNFSIAYNIVKIPPLQADKEDPISKSEI antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  27. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710397

    Description: epitope description:RKKYLNNKYRTSPFNLFHHINTYEDNGFLIV antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  28. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710399

    Description: epitope description:VYNYLYLANLRENWEEVKKNARKAPQPEV antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  29. Experimental autoimmune uveitis induced by immunization with retinal pigment epithelium-specific 65-kDa protein peptides.

    ID: 1710404

    Description: epitope description:GLGLNHFVPDRLCKLNVKTKETWVWQEPDS antigen name:Retinoid isomerohydrolase host organism:Rattus norvegicus Lewis

    Publication: 16109648;

  30. A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

    ID: 1710410

    Description: epitope description:AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 16327157;

  31. A new epitope of CYP2D6 recognized by liver kidney microsomal autoantibody from japanese patients with autoimmune hepatitis.

    ID: 1710411

    Description: epitope description:PFRFHPEHFLDAQGHFVK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 16327157;

  32. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710421

    Description: epitope description:GENHAKSKAVPYSEMYAN host organism:Oryctolagus cuniculus albino

    Publication: 11028906;

  33. Identification of functional epitopes of Pseudomonas aeruginosa exotoxin A using synthetic peptides and subclone products.

    ID: 1709637

    Description: epitope description:HESNEMQPT antigen name:Exotoxin A host organism:Rattus norvegicus Sprague-Dawley

    Publication: 1700288;

  34. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761120

    Description: epitope description:PRPPSRSQAQTPPRS antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  35. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761128

    Description: epitope description:PPRPDPRAPPARASY antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  36. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761129

    Description: epitope description:PRAPPARASYRRFRT antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  37. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761131

    Description: epitope description:RRFRTWPSATSWERR antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  38. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761137

    Description: epitope description:RLGGEGPGAGDRRRE antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  39. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761139

    Description: epitope description:DRRREGPDRSPRQPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  40. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761142

    Description: epitope description:VLPAAAAQPDSSSAQ antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  41. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761144

    Description: epitope description:SSSAQAPGPSTLRPA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  42. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761148

    Description: epitope description:KRRWATRGPAHPAFA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  43. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761160

    Description: epitope description:DPVGHPAAPRAPGPE antigen name:Uncharacterized protein LF3 host organism:Homo sapiens

    Publication: 15894513;

  44. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761161

    Description: epitope description:PRHGHSQGPWKPWSA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

    Publication: 15894513;

  45. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761166

    Description: epitope description:APWRRRRRWRTRRTR antigen name:Other Torque teno virus protein host organism:Homo sapiens

    Publication: 15894513;

  46. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761177

    Description: epitope description:PRPPSRSQAQTPPRS antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  47. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761182

    Description: epitope description:PQDPRSPGPAPRHRR antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  48. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761187

    Description: epitope description:ARASYRRFRTWPSAT antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  49. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761188

    Description: epitope description:RRFRTWPSATSWERR antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  50. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761190

    Description: epitope description:SWERRRLSPGHRALA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston