Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761197

    Description: epitope description:GPDRSPRQPPVLPAA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  2. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761198

    Description: epitope description:PRQPPVLPAAAAQPD antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  3. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761199

    Description: epitope description:VLPAAAAQPDSSSAQ antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  4. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761205

    Description: epitope description:KRRWATRGPAHPAFA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  5. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761213

    Description: epitope description:LWRCALRWAERQVGA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  6. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761214

    Description: epitope description:LRWAERQVGALGAES antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 15894513;

  7. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761220

    Description: epitope description:PRSRHPGGPGTPQIR antigen name:ORF2 host organism:Homo sapiens

    Publication: 15894513;

  8. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761222

    Description: epitope description:RVPRIPRDPRPPRPP antigen name:Probable RNA-binding protein host organism:Homo sapiens

    Publication: 15894513;

  9. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761224

    Description: epitope description:PSRRRRRRKATLAPA antigen name:Core-capsid bridging protein host organism:Homo sapiens

    Publication: 15894513;

  10. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761225

    Description: epitope description:WWARRRRRWRRWKRR antigen name:Other Torque teno virus protein host organism:Homo sapiens

    Publication: 15894513;

  11. Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

    ID: 1761226

    Description: epitope description:SVEVRKRRWVTFCSA antigen name:Gag polyprotein host organism:Homo sapiens

    Publication: 15894513;

  12. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761232

    Description: epitope description:GKFVLSSGKF antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  13. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761235

    Description: epitope description:EYNIMFGPDI antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  14. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761247

    Description: epitope description:KGKNVLINKD antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  15. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761251

    Description: epitope description:QVKSGTIFDN antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  16. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761253

    Description: epitope description:GTIFDNFLIT antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  17. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761261

    Description: epitope description:KSGTIFDNFL antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  18. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761266

    Description: epitope description:QVKSGTIFDN antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  19. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761267

    Description: epitope description:KSGTIFDNFL antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  20. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761268

    Description: epitope description:IFDNFLITND antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  21. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761271

    Description: epitope description:RLKEEEEDKK antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  22. Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

    ID: 1761275

    Description: epitope description:DEEKDKGLQTSQ antigen name:Calreticulin host organism:Homo sapiens

    Publication: 14624761;

  23. Pathogenic epitopes of autoantibodies in pemphigus reside in the amino-terminal adhesive region of desmogleins which are unmasked by proteolytic proce...

    ID: 1761278

    Description: epitope description:ERPLELRVRVLDI antigen name:Desmoglein-1 host organism:Homo sapiens antibody name:3–30/3h

    Publication: 19340014;

  24. Production of thyroid-stimulating antibodies in mice by immunization with T-cell epitopes of human thyrotropin receptor.

    ID: 1761383

    Description: epitope description:TKVYSTDIFFILEITDNPY antigen name:Thyrotropin receptor host organism:Mus musculus DBA/1

    Publication: 7534706;

  25. Reversible contraception in female baboons immunized with a synthetic epitope of sperm-specific lactate dehydrogenase.

    ID: 1761490

    Description: epitope description:EKLIEDDENSQC antigen name:L-lactate dehydrogenase C chain host organism:Papio cynocephalus

    Publication: 7536050;

  26. Comparative effectiveness of the cholera toxin B subunit and alkaline phosphatase as carriers for oral vaccines.

    ID: 1761491

    Description: epitope description:SAWNSDSEKPFDDHL antigen name:UniProt:I6TY13 host organism:Mus musculus C57BL/6

    Publication: 8418065;

  27. A contraceptive peptide vaccine targeting sulfated glycoprotein ZP2 of the mouse zona pellucida.

    ID: 1761506

    Description: epitope description:RGTVLYKNEVGE host organism:Rattus antibody name:IE-3

    Publication: 10084964;

  28. Production of monoclonal mouse IgE antibodies with DNP specificity by hybrid cell lines.

    ID: 1761509

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus BALB/c

    Publication: 6153172;

  29. A contraceptive peptide vaccine targeting sulfated glycoprotein ZP2 of the mouse zona pellucida.

    ID: 1761510

    Description: epitope description:TDVRYKD antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 10084964;

  30. Localization of an immunodominant domain on baculovirus-produced parvovirus B19 capsids: correlation to a major surface region on the native virus par...

    ID: 1761514

    Description: epitope description:TTYGNA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:PAR1

    Publication: 1433504;

  31. Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

    ID: 1761532

    Description: epitope description:ATKKEEEKKGGDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGERRNTDTR antigen name:Leiomodin-1 host organism:Homo sapiens

    Publication: 7586727;

  32. Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

    ID: 1761534

    Description: epitope description:LLKENTSLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKR antigen name:Leiomodin-1 host organism:Homo sapiens

    Publication: 7586727;

  33. Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

    ID: 1761535

    Description: epitope description:LLKENTSLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKR antigen name:Leiomodin-1 host organism:Homo sapiens

    Publication: 7586727;

  34. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761543

    Description: epitope description:PKRKAEGDAKGDKAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

    Publication: 12523645;

  35. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761544

    Description: epitope description:PKRKAEGDAKGDKAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  36. Platinum group metal sensitivity: reactivity to platinum group metal salts in platinum halide salt-sensitive workers.

    ID: 1761548

    Description: epitope description:ammonium hexachloroplatinate host organism:Homo sapiens

    Publication: 3122607;

  37. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761555

    Description: epitope description:AKGDKAKVKDEPQRR antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  38. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761558

    Description: epitope description:KAKVKDEPQRRSARL antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  39. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761562

    Description: epitope description:QRRSARLSAKPAPPK antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

    Publication: 12523645;

  40. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761576

    Description: epitope description:EPKPKKAPAKKGEKV antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  41. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761577

    Description: epitope description:KKAPAKKGEKVPKGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

    Publication: 12523645;

  42. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761578

    Description: epitope description:KKAPAKKGEKVPKGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  43. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761579

    Description: epitope description:KKAPAKKGEKVPKGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  44. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761585

    Description: epitope description:EKVPKGKKGKADAGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

    Publication: 12523645;

  45. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761589

    Description: epitope description:GKADAGKDGNNPAEN antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

    Publication: 12523645;

  46. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761598

    Description: epitope description:AENGDAKTDQAQKAE antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

    Publication: 12523645;

  47. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761607

    Description: epitope description:AGAAKKPKKATGAAT antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 12523645;

  48. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761617

    Description: epitope description:KPKAAKPKKAAAKKK antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 12523645;

  49. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761629

    Description: epitope description:PPAKVEAKPKKAAAK antigen name:Non-histone chromosomal protein HMG-14 host organism:Homo sapiens

    Publication: 12523645;

  50. Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

    ID: 1761630

    Description: epitope description:PPAKVEAKPKKAAAK antigen name:Non-histone chromosomal protein HMG-14 host organism:Homo sapiens

    Publication: 12523645;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston