Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. A versatile system for the production of recombinant chimeric peptides.

    ID: 1080742

    Description: epitope description:DQVHFQPLPPAVVKLSDALI antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10 antibody name:Anti-Ag38 350...

    Publication: 7529809;

  2. A versatile system for the production of recombinant chimeric peptides.

    ID: 1081363

    Description: epitope description:DQVHFQPLPPAVVKLSDALI antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10 antibody name:Anti-Ag38 350...

    Publication: 7529809;

  3. A versatile system for the production of recombinant chimeric peptides.

    ID: 1084560

    Description: epitope description:KQDPEGWGKSPGFGTTVDFP antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10 antibody name:Anti-Ag38 G 3...

    Publication: 7529809;

  4. A versatile system for the production of recombinant chimeric peptides.

    ID: 1090326

    Description: epitope description:DQVHFQPLPPAVVKLSDALI antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10 antibody name:Anti-Ag38

    Publication: 7529809;

  5. Mapping of the antigenic determinants recognized by monoclonal antibodies against the M2 protein of rabies virus.

    ID: 1106275

    Description: epitope description:AIKDLKKPCITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCS antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:MoAb 6, 7, 13...

    Publication: 1372139;

  6. Epitope specificity and isoforms of the mycobacterial 19-kilodalton antigen.

    ID: 1162723

    Description: epitope description:VKRGLTVAVAGAAILVAGLS antigen name:Probable lipoprotein aminopeptidase LpqL (UniProt:L0T5B2) host organism:Mus musculus C57BL/10

    Publication: 7516315;

  7. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1206391

    Description: epitope description:IYCGNGTPSELGGANVPAEFLENFVRSSNLKFQDAYNA host organism:Mus musculus BALB/c

    Publication: 9714413;

  8. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1206394

    Description: epitope description:EFLENFVRSSNLKFQDAYNAAGGHNAVFNLDANGTHSWEY host organism:Mus musculus C57BL/6

    Publication: 9714413;

  9. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1207198

    Description: epitope description:HNAVFNLDANGTHSWEYWGAQLNAMKGDLQ host organism:Mus musculus C57BL/6

    Publication: 9714413;

  10. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1207328

    Description: epitope description:WGAQLNAMKGDLQASLGAR host organism:Oryctolagus cuniculus

    Publication: 9714413;

  11. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1207332

    Description: epitope description:FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLD host organism:Mus musculus C57BL/6

    Publication: 9714413;

  12. Lassa virus glycoproteins: antigenic and immunogenic properties of synthetic peptides to GP1.

    ID: 1209200

    Description: epitope description:NLSDAHKKNLYDHAL antigen name:Pre-glycoprotein polyprotein GP complex host organism:Oryctolagus cuniculus

    Publication: 1701079;

  13. Lassa virus glycoproteins: antigenic and immunogenic properties of synthetic peptides to GP1.

    ID: 1209204

    Description: epitope description:VQYNLSHSYAGDA antigen name:Pre-glycoprotein polyprotein GP complex host organism:Mus musculus CBA

    Publication: 1701079;

  14. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19265

    Description: epitope description:QAYAGVRKRYVAKPSD antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  15. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19277

    Description: epitope description:TTTQLVVAITALLITA antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  16. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19279

    Description: epitope description:ITALLITAFAICACLE antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  17. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19287

    Description: epitope description:FAICACLEPRLIGASG antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  18. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19291

    Description: epitope description:PRLIGASGPLIWGCLA antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  19. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19295

    Description: epitope description:PLIWGCLALVALLPLL antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  20. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19297

    Description: epitope description:PLIWGCLALVALLPLL antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston