Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486997

    Description: epitope description:IVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  2. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486999

    Description: epitope description:FNWTHCFDPQI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  3. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487000

    Description: epitope description:SPCHNSLILP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  4. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487002

    Description: epitope description:NTEPSQLPPTA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  5. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487013

    Description: epitope description:DAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILE antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  6. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487025

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  7. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487026

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  8. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487027

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  9. Sensitive detection of cereal fractions that are toxic to celiac disease patients by using monoclonal antibodies to a main immunogenic wheat peptide.

    ID: 1487033

    Description: epitope description:LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musc...

    Publication: 18258632;

  10. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487057

    Description: epitope description:C181, N182, A183, S184, K185, F186, H187, Q188, G189, C190, L191, L192, V193, V194, C195, V196, P197, E198, A199, E200, M201, G20...

    Publication: 12029154;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston