Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19397

    Description: epitope description:PGTSVPSAGSGSVPPA antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  2. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19401

    Description: epitope description:GSGSVPPATIMVSVDP antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  3. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19405

    Description: epitope description:TIMVSVDPQLVATLGA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  4. Characterization of new epidemic strains of influenza B virus by using neutralizing monoclonal antibodies.

    ID: 19510

    Description: epitope description:G138, R146 antigen name:Hemagglutinin host organism:Mus musculus antibody name:5H4 and 8B3

    Publication: 11745940;

  5. A strategy for searching antigenic regions in the SARS-CoV spike protein.

    ID: 20324

    Description: epitope description:DCSQNPLAELKCSVKSFEIDKG antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15629033;

  6. A strategy for searching antigenic regions in the SARS-CoV spike protein.

    ID: 20331

    Description: epitope description:FKEELDKYFKNHTSPDVD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15629033;

  7. A strategy for searching antigenic regions in the SARS-CoV spike protein.

    ID: 20333

    Description: epitope description:KGACSCGSCCKFDEDDSEPVLK antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15629033;

  8. Induction of influenza type A virus-specific resistance by immunization of mice with a synthetic multiple antigenic peptide vaccine that contains ecto...

    ID: 20335

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSSDP antigen name:Matrix protein 2 host organism:Mus musculus antibody name:14C2

    Publication: 12744898;

  9. Inhibition of staphylococcal enterotoxin A-induced superantigenic and lethal activities by a monoclonal antibody to toxic shock syndrome toxin-1.

    ID: 20337

    Description: epitope description:ELDLQARR antigen name:Enterotoxin type A host organism:Mus musculus BALB/c antibody name:MAb5

    Publication: 11372026;

  10. Inhibition of staphylococcal enterotoxin A-induced superantigenic and lethal activities by a monoclonal antibody to toxic shock syndrome toxin-1.

    ID: 20441

    Description: epitope description:YYSPAF antigen name:UniProt:D6SEW7 host organism:Mus musculus BALB/c antibody name:MAb5

    Publication: 11372026;

  11. Inhibition of staphylococcal enterotoxin A-induced superantigenic and lethal activities by a monoclonal antibody to toxic shock syndrome toxin-1.

    ID: 20485

    Description: epitope description:YYSPAF antigen name:UniProt:D6SEW7 host organism:Mus musculus BALB/c antibody name:MAb5

    Publication: 11372026;

  12. Genomic analysis of matrix gene and antigenic studies of its gene product (M1) of a swine influenza virus (H1N1) causing chronic respiratory disease i...

    ID: 21013

    Description: epitope description:LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGD antigen name:Matrix protein 1 host organism:Mus musculus antibody name:M1-1C6

    Publication: 11129631;

  13. Genomic analysis of matrix gene and antigenic studies of its gene product (M1) of a swine influenza virus (H1N1) causing chronic respiratory disease i...

    ID: 21014

    Description: epitope description:LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGD antigen name:Matrix protein 1 host organism:Mus musculus antibody name:M1-1C6

    Publication: 11129631;

  14. Genomic analysis of matrix gene and antigenic studies of its gene product (M1) of a swine influenza virus (H1N1) causing chronic respiratory disease i...

    ID: 21016

    Description: epitope description:GLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQ antigen name:Matrix protein 1 host organism:Mus musculus antibody name:M1-289/4

    Publication: 11129631;

  15. MUC1 mucin-mediated regulation of human T cells.

    ID: 21036

    Description: epitope description:APDTRPAP antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:DF3 anti-MUC1 Ab

    Publication: 15710907;

  16. MUC1 mucin-mediated regulation of human T cells.

    ID: 21040

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:DH-1 ...

    Publication: 15710907;

  17. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21394

    Description: epitope description:AVTLAHELIHAGHR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  18. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21397

    Description: epitope description:AVTLAHELIHAGHR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  19. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21434

    Description: epitope description:TFNFDNEPENISIENLSSD antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;

  20. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21438

    Description: epitope description:NLSSDIIGQLELMPNIERF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston