Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

    ID: 1409856

    Description: epitope description:LIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY antigen name:Api m 1 host organism:Mus musculus CBA/J

    Publication: 10975871;

  2. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409868

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Oryctolagus cuniculus antibody name:anti-Chi t I

    Publication: 2464134;

  3. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409870

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Mus musculus BALB/c antibody name:mAb 5, 6, 7, 15

    Publication: 2464134;

  4. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409872

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C3H/He

    Publication: 10225836;

  5. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409910

    Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Mus musculus C57BL/6

    Publication: 10225836;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston