Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436299

    Description: epitope description:DPLLRTAP antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  2. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436301

    Description: epitope description:LLRTAPGP antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  3. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436303

    Description: epitope description:RTAPGPGE antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  4. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436304

    Description: epitope description:TAPGPGEV antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  5. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436307

    Description: epitope description:GPGEVWVT antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  6. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436308

    Description: epitope description:PGEVWVTP antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  7. Structure of rubella E1 glycoprotein epitopes established by multiple peptide synthesis.

    ID: 1436312

    Description: epitope description:WVTPVIGS antigen name:Structural polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 1690535;

  8. Evaluation of synthetic, M type-specific peptides as antigens in a multivalent group A streptococcal vaccine.

    ID: 1459112

    Description: epitope description:LDQVTQLYNKHNSNYQQYSA antigen name:UniProt:A2RGM0 host organism:Mus musculus Swiss Webster

    Publication: 12798606;

  9. Evaluation of synthetic, M type-specific peptides as antigens in a multivalent group A streptococcal vaccine.

    ID: 1459113

    Description: epitope description:LEDLGQKFERLKQRSELYLQ antigen name:UniProt:A2RGM0 host organism:Mus musculus Swiss Webster

    Publication: 12798606;

  10. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1459117

    Description: epitope description:NKNDNKND antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Oryctolagus cuniculus New...

    Publication: 17548134;

  11. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies.

    ID: 1459184

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;

  12. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies.

    ID: 1459189

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;

  13. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis.

    ID: 1459481

    Description: epitope description:PRSLFPEFSELFAAFPSFAG antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;

  14. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis.

    ID: 1459483

    Description: epitope description:DPDKDVDIMVRDGQLTIKAE antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;

  15. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1459492

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Bos taurus antibody name:Cattle sera

    Publication: 2157884;

  16. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases.

    ID: 1459524

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;

  17. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases.

    ID: 1459525

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;

  18. Vaccination against gonorrhoea: the potential protective effect of immunization with a synthetic peptide containing a conserved epitope of gonococcal ...

    ID: 1459543

    Description: epitope description:DDQTYSIPSLFV antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Oryctolagus cuniculus

    Publication: 1694611;

  19. Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid.

    ID: 1459585

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum

    Publication: 15841217;

  20. Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid.

    ID: 1459587

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum

    Publication: 15841217;

  21. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459603

    Description: epitope description:NVSAIFMAVLLTLQT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  22. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459608

    Description: epitope description:SKIGVVGIGSASYKV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  23. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459609

    Description: epitope description:VGIGSASYKVMTRSS antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  24. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459622

    Description: epitope description:VQSVASSRRHKRFAG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  25. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459624

    Description: epitope description:KRFAGVVLAGAALGV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  26. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459634

    Description: epitope description:IEAIRQAGQEMILAV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  27. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459635

    Description: epitope description:QAGQEMILAVQGVQD antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  28. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459639

    Description: epitope description:LIPSMNQLSCDLIGQ antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  29. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459649

    Description: epitope description:YALGGDINKVLEKLG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  30. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459655

    Description: epitope description:KARITHVDTESYFIV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  31. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459659

    Description: epitope description:PTLSEIKGVIVHRLE antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  32. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459664

    Description: epitope description:WYTTVPKYVATQGYL antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  33. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459666

    Description: epitope description:TQGYLISNFDESSCT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  34. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459670

    Description: epitope description:TVCSQNALYPMSPLL antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  35. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459676

    Description: epitope description:VSGSFGNRFILSQGN antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  36. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459679

    Description: epitope description:LIANCASILCKCYTT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  37. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459685

    Description: epitope description:AADHCPVVEVNGVTI antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  38. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459687

    Description: epitope description:NGVTIQVGSRRYPDA antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  39. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459692

    Description: epitope description:PISLERLDVGTNLGN antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  40. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459694

    Description: epitope description:TNLGNAIAKLEDAKE antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  41. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459695

    Description: epitope description:AIAKLEDAKELLESS antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  42. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459701

    Description: epitope description:VYILIAVCLGGLIGI antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  43. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera.

    ID: 1459709

    Description: epitope description:KPDLTGTSKSYVRSL antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

  44. Antipeptide antisera define neutralizing epitopes on the adenovirus hexon.

    ID: 1459728

    Description: epitope description:TSLNDRQGNATK antigen name:Hexon protein host organism:Oryctolagus cuniculus antibody name:Rabbit Serum

    Publication: 1376769;

  45. Antipeptide antisera define neutralizing epitopes on the adenovirus hexon.

    ID: 1459729

    Description: epitope description:KANGNGSGDNGDTTW antigen name:Hexon protein host organism:Oryctolagus cuniculus antibody name:Rabbit Serum

    Publication: 1376769;

  46. A B cell-, T cell-linked epitope located on the adhesin of Mycoplasma pneumoniae.

    ID: 1459743

    Description: epitope description:STNTSGSR antigen name:Adhesin P1 host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 1695202;

  47. Antipeptide antisera define neutralizing epitopes on the adenovirus hexon.

    ID: 1459751

    Description: epitope description:TSLNDRQGNATK antigen name:Hexon protein host organism:Homo sapiens antibody name:Human Serum

    Publication: 1376769;

  48. Antipeptide antisera define neutralizing epitopes on the adenovirus hexon.

    ID: 1459752

    Description: epitope description:KANGNGSGDNGDTTW antigen name:Hexon protein host organism:Homo sapiens antibody name:Human Serum

    Publication: 1376769;

  49. A B cell-, T cell-linked epitope located on the adhesin of Mycoplasma pneumoniae.

    ID: 1459763

    Description: epitope description:PTFSNIGV antigen name:Adhesin P1 host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 1695202;

  50. High-affinity antibody induced by immunization with a synthetic peptide is associated with protection of cattle against foot-and-mouth disease.

    ID: 1459798

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Bos taurus Friesian antibody name:Cattle sera

    Publication: 1847695;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston