Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409207

    Description: epitope description:KTCTTPA antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  2. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409215

    Description: epitope description:GNSMFPS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  3. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409221

    Description: epitope description:SCCCTKP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  4. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409222

    Description: epitope description:CCCTKPT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  5. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409227

    Description: epitope description:PTDGNCT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  6. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409228

    Description: epitope description:TDGNCTC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  7. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409232

    Description: epitope description:CTCIPIP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  8. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409237

    Description: epitope description:IPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  9. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409243

    Description: epitope description:FAKYLWE antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  10. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409251

    Description: epitope description:ASVRFSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  11. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409252

    Description: epitope description:SVRFSWL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  12. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409253

    Description: epitope description:VRFSWLS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  13. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409261

    Description: epitope description:LVPFVQW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  14. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409263

    Description: epitope description:PFVQWFV antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  15. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409265

    Description: epitope description:VQWFVGL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  16. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409272

    Description: epitope description:SPTVWLS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  17. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409274

    Description: epitope description:TVWLSAI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  18. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409281

    Description: epitope description:WMMWYWG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  19. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409286

    Description: epitope description:WGPSLYS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  20. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409293

    Description: epitope description:IVSPFIP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  21. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409295

    Description: epitope description:SPFIPLL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  22. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409296

    Description: epitope description:PFIPLLP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  23. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409298

    Description: epitope description:IPLLPIF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  24. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409299

    Description: epitope description:PLLPIFF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  25. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409301

    Description: epitope description:LPIFFCL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  26. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409304

    Description: epitope description:FFCLWVY antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  27. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409305

    Description: epitope description:FCLWVYI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  28. Identification of IgE-binding epitopes of the major peach allergen Pru p 3.

    ID: 1409308

    Description: epitope description:VSSSLAPCIP antigen name:Non-specific lipid-transfer protein host organism:Homo sapiens

    Publication: 13679821;

  29. Identification of IgE-binding epitopes of the major peach allergen Pru p 3.

    ID: 1409309

    Description: epitope description:APCIPYVRGG antigen name:Non-specific lipid-transfer protein host organism:Homo sapiens

    Publication: 13679821;

  30. Monoclonal antibodies to denatured ragweed pollen allergen Amb a I: characterization, specificity for the denatured allergen, and utilization for the ...

    ID: 1409414

    Description: epitope description:GMLATVAFNTFTDNVDQR antigen name:Amb a 1 host organism:Mus musculus BALB/c antibody name:JB1C6-5, JB3D3-3, JB4F3-5, JB5F2-2

    Publication: 2456454;

  31. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409758

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 16282606;

  32. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409759

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 16282606;

  33. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409763

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BA...

    Publication: 16282606;

  34. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409777

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 1372290;

  35. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409778

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S5-10

    Publication: 1372290;

  36. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409783

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-27, S25-2

    Publication: 1372290;

  37. Elimination of immune tolerance to hepatitis virus in an animal model.

    ID: 1409786

    Description: epitope description:TPEEDQDAREAFRRYQEERPPE antigen name:Large envelope protein host organism:Anas

    Publication: 1395838;

  38. Detection of human antibodies using ""convergent"" combinatorial peptide libraries or ""mixotopes"" designed from a nonvariable antigen: application t...

    ID: 1409790

    Description: epitope description:AVDTGSGGGGQPHDTAPRGARKKQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 9924994;

  39. Production and characterization of peptide mimotopes of phenolic glycolipid-I of Mycobacterium leprae.

    ID: 1409799

    Description: epitope description:WTLGPYV host organism:Mus musculus BALB/c antibody name:III603.8

    Publication: 15094167;

  40. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409817

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:L2I-6

    Publication: 1372290;

  41. Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

    ID: 1409856

    Description: epitope description:LIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY antigen name:Api m 1 host organism:Mus musculus CBA/J

    Publication: 10975871;

  42. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409868

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Oryctolagus cuniculus antibody name:anti-Chi t I

    Publication: 2464134;

  43. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409870

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Mus musculus BALB/c antibody name:mAb 5, 6, 7, 15

    Publication: 2464134;

  44. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409872

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C3H/He

    Publication: 10225836;

  45. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409910

    Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Mus musculus C57BL/6

    Publication: 10225836;

  46. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409913

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C57BL/6

    Publication: 10225836;

  47. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409915

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C57BL/6

    Publication: 10225836;

  48. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410106

    Description: epitope description:APSSPGTPGVAAATQAANGG antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1817

    Publication: 1380051;

  49. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410116

    Description: epitope description:YREGSHTEHTSYAADRFKQVDGFYAR antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1819

    Publication: 1380051;

  50. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410178

    Description: epitope description:Y278 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1435

    Publication: 1380051;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston