Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A 40-kilodalton cell wall protein-coding sequence upstream of the sr gene of Streptococcus mutans OMZ175 (serotype f).

    ID: 1714659

    Description: epitope description:SNPQVNVETDSSEKDE antigen name:UniProt:I6SU99 host organism:Oryctolagus cuniculus

    Publication: 2019433;

  2. Novel monoclonal antibodies against Menangle virus nucleocapsid protein.

    ID: 1714795

    Description: epitope description:PPIPQMPQNIDWEVRLAEIERRNQQMAARDR antigen name:Menangle rubulavirus protein host organism:Mus musculus BALB/c antibody name:10G8

    Publication: 19898771;

  3. Monoclonal antibodies to the human TSH receptor: epitope mapping and binding to the native receptor on the basolateral plasma membrane of thyroid foll...

    ID: 1714810

    Description: epitope description:SDEFNPCEDIMGYK antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 antibody name:A7

    Publication: 9156519;

  4. A protective immune response against lethal, dermonecrotic and hemorrhagic effects of Loxosceles intermedia venom elicited by a 27-residue peptide.

    ID: 1714821

    Description: epitope description:NLGANSIETDVSFDDNANPEYTYHGIP antigen name:Phospholipase D LiSicTox-alphaIA1bii host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 19818803;

  5. A protective immune response against lethal, dermonecrotic and hemorrhagic effects of Loxosceles intermedia venom elicited by a 27-residue peptide.

    ID: 1714825

    Description: epitope description:NLGANSIETDVSFDDNANPEYTYHGIP antigen name:Phospholipase D LiSicTox-alphaIA1bii host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 19818803;

  6. Antibodies against homologous microbial caseinolytic proteases P characterise primary biliary cirrhosis.

    ID: 1714840

    Description: epitope description:RIEKDTDRDNFMSAEEAQ antigen name:Other Haemophilus influenzae protein host organism:Homo sapiens

    Publication: 11804659;

  7. Immunogenicity and contraceptive potential of a human zona pellucida 3 peptide vaccine.

    ID: 1714852

    Description: epitope description:QPHVMS antigen name:Zona pellucida sperm-binding protein 3 host organism:Macaca fascicularis

    Publication: 9047023;

  8. Part II: influence of dimerization of a modified GnRH-I peptide sequence on a male antifertility vaccine.

    ID: 1714862

    Description: epitope description:HWSYGLRPG antigen name:Progonadoliberin-1 host organism:Rattus norvegicus Sprague-Dawley

    Publication: 12607773;

  9. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714918

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  10. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714922

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  11. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714923

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  12. Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody.

    ID: 1714925

    Description: epitope description:E101, G105, S106, D107, T110, G111, E112, P113, S114, H125, P152, S153, Q154, P155, W156, R158, L159 antigen name:Interleukin-23 s...

    Publication: 18708069;

  13. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714936

    Description: epitope description:KVAAEQSLITVEGDK antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex host organi...

    Publication: 16025495;

  14. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714937

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  15. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714947

    Description: epitope description:NENIKELLDKINEIKNPPPANSGNTPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  16. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714949

    Description: epitope description:NENIKKLLEDIDKIKTDAENPTTGSKPNPLPENKKKEVEG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  17. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714954

    Description: epitope description:NENIKKLLDKINEIKNPPPANSGNTPNPLPENKKKEVEG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  18. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714957

    Description: epitope description:NENIKKLLDKINEIKNPPPANSGNTPNPLPENKKKEVEG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  19. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714960

    Description: epitope description:NENIKKLLEDIDKIKTDAEKPTTGSKPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  20. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714962

    Description: epitope description:NENIKKLLEDIDKIKTDAEKPTTGSKPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  21. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714963

    Description: epitope description:NENIKKLLEDIDKIKTDAEKPTTGSKPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  22. Antigenic domains analysis of classical swine fever virus E2 glycoprotein by mutagenesis and conformation-dependent monoclonal antibodies.

    ID: 1714972

    Description: epitope description:C5, C49, L83, L84, F85, D86 antigen name:Genome polyprotein host organism:Mus musculus antibody name:C2, L7, L150

    Publication: 20132851;

  23. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1715515

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-813

    Publication: 10611069;

  24. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1715516

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-825

    Publication: 10611069;

  25. Structure and kinetics of a transient antibody binding intermediate reveal a kinetic discrimination mechanism in antigen recognition.

    ID: 1716456

    Description: epitope description:furazolidone host organism:Mus musculus C57BL/6 antibody name:SPE7

    Publication: 16129832;

  26. Structure and kinetics of a transient antibody binding intermediate reveal a kinetic discrimination mechanism in antigen recognition.

    ID: 1716457

    Description: epitope description:furazolidone host organism:Mus musculus C57BL/6 antibody name:SPE7

    Publication: 16129832;

  27. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716498

    Description: epitope description:GSSWEGVGVVPDV antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  28. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716499

    Description: epitope description:WEGVGVVPDVAVP antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  29. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716501

    Description: epitope description:GECWLGGGVVPDA antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  30. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716506

    Description: epitope description:WEGVGVVPDV antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  31. Endocytotic segregation of gliadin peptide 31-49 in enterocytes.

    ID: 1716515

    Description: epitope description:GQQQPFPPQ antigen name:Tri a 21 host organism:Mus musculus BALB/c antibody name:WB8

    Publication: 19654123;

  32. Screening and identification of dominant functional fragments of human epididymal protease inhibitor.

    ID: 1716536

    Description: epitope description:TCSMFVYGGC antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 20005859;

  33. Screening and identification of dominant functional fragments of human epididymal protease inhibitor.

    ID: 1716540

    Description: epitope description:FVYGGCQGNN antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 20005859;

  34. Screening and identification of dominant functional fragments of human epididymal protease inhibitor.

    ID: 1716544

    Description: epitope description:NNNNFQSKAN antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 20005859;

  35. Endocytotic segregation of gliadin peptide 31-49 in enterocytes.

    ID: 1716554

    Description: epitope description:QQQPFP antigen name:Tri a 21 host organism:Mus musculus BALB/c antibody name:R5

    Publication: 19654123;

  36. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716556

    Description: epitope description:SLRGRGNTLGLD antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:6A4, 2H6

    Publication: 20087939;

  37. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716558

    Description: epitope description:SLRGRGNTLGLD antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:6A4, 2H6

    Publication: 20087939;

  38. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716562

    Description: epitope description:RLPLPPNQKR antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:1G1

    Publication: 20087939;

  39. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716563

    Description: epitope description:RLPLPPNQKR antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:1G1

    Publication: 20087939;

  40. Characterization and epitope mapping of monoclonal antibodies recognizing N-terminus of Rep of porcine circovirus type 2.

    ID: 1716588

    Description: epitope description:LFDYFIVG antigen name:Replication-associated protein host organism:Mus musculus BALB/c antibody name:1C1

    Publication: 20152863;

  41. Characterization and epitope mapping of monoclonal antibodies recognizing N-terminus of Rep of porcine circovirus type 2.

    ID: 1716602

    Description: epitope description:KEGNLLIE antigen name:Replication-associated protein host organism:Mus musculus BALB/c antibody name:3D10

    Publication: 20152863;

  42. Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect.

    ID: 1716642

    Description: epitope description:VNIPFVRL antigen name:NFX1-type zinc finger-containing protein 1 host organism:Mus musculus C57BL/10 antibody name:HD42

    Publication: 20093428;

  43. Germline humanization of a murine Abeta antibody and crystal structure of the humanized recombinant Fab fragment.

    ID: 1716643

    Description: epitope description:EFRH antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:WO-2

    Publication: 20014445;

  44. Antiserum to an inhibin alpha-chain peptide neutralizes inhibin bioactivity and increases ovulation rate in sheep.

    ID: 1716663

    Description: epitope description:MPLLWLRGFLLASCWIIVRSSPTPG antigen name:Inhibin beta A chain host organism:Ovis aries

    Publication: 1707868;

  45. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716742

    Description: epitope description:LARYGPAWREQRRFSVSTLR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  46. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716748

    Description: epitope description:LAQEGLKEESGFLREVLNAV antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  47. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716749

    Description: epitope description:VLNAVPVLLHIPALAGKVLR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  48. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716755

    Description: epitope description:TLAWGLLLMILHPDVQRRVQ antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  49. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716759

    Description: epitope description:GVTHMTSRDIEVQGFRIPKG antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  50. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716761

    Description: epitope description:LKDEAVWEKPFRFHPEHFLD antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston