Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716770

    Description: epitope description:ARYPPGPLPLPGLGNLLHVD antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  2. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716775

    Description: epitope description:ITQILGFGPRSQGVFLARYG antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  3. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716776

    Description: epitope description:LARYGPAWREQRRFSVSTLR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  4. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716780

    Description: epitope description:AVSNVIASLTCGRRFEYDDP antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  5. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716781

    Description: epitope description:RRFEYDDPRFLRLLDLAQEG antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  6. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716782

    Description: epitope description:LAQEGLKEESGFLREVLNAV antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  7. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716784

    Description: epitope description:GKVLRFQKAFLTQLDELLTE antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  8. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716786

    Description: epitope description:PRDLTEAFLAEMEKAKGNPE antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  9. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716793

    Description: epitope description:GVTHMTSRDIEVQGFRIPKG antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  10. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716796

    Description: epitope description:EHFLDAQGHFVKPEAFLPFS antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  11. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716797

    Description: epitope description:FLPFSAGRRACLGEPLARME antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  12. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716800

    Description: epitope description:HGVFAFLVSPSPYELCAVPR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  13. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1713016

    Description: epitope description:SSTSGFTPG antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  14. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1713018

    Description: epitope description:TSGFTPGGG antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  15. Characterization of BALB/c mice B lymphocyte autoimmune responses to skin basement membrane component type XVII collagen, the target antigen of autoim...

    ID: 1713025

    Description: epitope description:EEVRKLKARVEELEKT antigen name:Collagen alpha-1(XVII) chain host organism:Mus musculus BALB/c

    Publication: 11377704;

  16. Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas.

    ID: 1713038

    Description: epitope description:LNAASAIGMKMQDVDLFINR antigen name:O-phosphoseryl-tRNA(Sec) selenium transferase host organism:Homo sapiens

    Publication: 11826415;

  17. Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas.

    ID: 1713041

    Description: epitope description:LFINRLDRCLKAVRKERSKE antigen name:O-phosphoseryl-tRNA(Sec) selenium transferase host organism:Homo sapiens

    Publication: 11826415;

  18. Fine specificity of autoantibodies to soluble liver antigen and liver/pancreas.

    ID: 1713046

    Description: epitope description:KSRDSDDEYDEDKPPIQVDPGRVDNVLTDS antigen name:Phosphoprotein 85 host organism:Homo sapiens

    Publication: 11826415;

  19. Identification of thyroiditogenic epitope on porcine thyroid peroxidase for C57BL/6 mice.

    ID: 1713144

    Description: epitope description:VEDGGFLLCEERGQRVLVFSCRHGFRLRG antigen name:Thyroid peroxidase host organism:Mus musculus C57BL/6

    Publication: 1372023;

  20. Identification of thyroiditogenic epitope on porcine thyroid peroxidase for C57BL/6 mice.

    ID: 1713149

    Description: epitope description:ARCKNTKGGVLCECSDPL antigen name:Thyroid peroxidase host organism:Mus musculus C57BL/6

    Publication: 1372023;

  21. Nonrheumatoid IgM in human hepatitis C virus-associated type II cryoglobulinemia recognize mimotopes of the CD4-like LAG-3 protein.

    ID: 1713162

    Description: epitope description:GHPLAPPQA host organism:Homo sapiens

    Publication: 8871676;

  22. Nonrheumatoid IgM in human hepatitis C virus-associated type II cryoglobulinemia recognize mimotopes of the CD4-like LAG-3 protein.

    ID: 1713164

    Description: epitope description:GHPLAPPQA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8871676;

  23. Nonrheumatoid IgM in human hepatitis C virus-associated type II cryoglobulinemia recognize mimotopes of the CD4-like LAG-3 protein.

    ID: 1713166

    Description: epitope description:GHPLAPPQA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8871676;

  24. Helix stabilization in the C-terminal peptide of chicken riboflavin carrier protein enhances immunogenicity and prolongs contraceptive potential as an...

    ID: 1713168

    Description: epitope description:HACQKKLLKFEALQQEEGEE antigen name:Riboflavin-binding protein host organism:Oryctolagus cuniculus albino

    Publication: 11549280;

  25. Nonrheumatoid IgM in human hepatitis C virus-associated type II cryoglobulinemia recognize mimotopes of the CD4-like LAG-3 protein.

    ID: 1713169

    Description: epitope description:HPLAPPHPS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8871676;

  26. Nonrheumatoid IgM in human hepatitis C virus-associated type II cryoglobulinemia recognize mimotopes of the CD4-like LAG-3 protein.

    ID: 1713180

    Description: epitope description:HPLATGPHL host organism:Homo sapiens

    Publication: 8871676;

  27. Nonrheumatoid IgM in human hepatitis C virus-associated type II cryoglobulinemia recognize mimotopes of the CD4-like LAG-3 protein.

    ID: 1713182

    Description: epitope description:HPLSPHPSY host organism:Homo sapiens

    Publication: 8871676;

  28. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713204

    Description: epitope description:TWLLLLGLLFGLIA antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  29. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713207

    Description: epitope description:GLLFGLIALAEEVRKLKAR antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  30. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713212

    Description: epitope description:ALAEEVRKLKARVD antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  31. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713213

    Description: epitope description:ALAEEVRKLKARVD antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  32. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713215

    Description: epitope description:ALAEEVRKLKARVD antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  33. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713230

    Description: epitope description:SILPYGDSMDRIEK antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  34. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713237

    Description: epitope description:SMDRIEKDRLQGMAPAA antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11916132;

  35. Cicatricial pemphigoid differs from bullous pemphigoid and pemphigoid gestationis regarding the fine specificity of autoantibodies to the BP180 NC16A ...

    ID: 1713239

    Description: epitope description:SMDRIEKDRLQGMAPAA antigen name:Collagen alpha-1(XVII) chain host organism:Oryctolagus cuniculus

    Publication: 11916132;

  36. Delineation of the discontinuous-conformational epitope of a monoclonal antibody displaying full in vitro and in vivo thyrotropin activity.

    ID: 1713258

    Description: epitope description:T62, K64, R86, Y88, R115, F136, G138, F140 antigen name:Thyrotropin receptor host organism:Mus musculus antibody name:1H7

    Publication: 15319453;

  37. Delineation of the discontinuous-conformational epitope of a monoclonal antibody displaying full in vitro and in vivo thyrotropin activity.

    ID: 1713264

    Description: epitope description:Q51, Q97 antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:IRI-SAb1

    Publication: 15319453;

  38. Delineation of the discontinuous-conformational epitope of a monoclonal antibody displaying full in vitro and in vivo thyrotropin activity.

    ID: 1713276

    Description: epitope description:I66, E67, Y88, I91, E113, R115, F136, G138, F140, E163, K189 antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 15319453;

  39. Delineation of the discontinuous-conformational epitope of a monoclonal antibody displaying full in vitro and in vivo thyrotropin activity.

    ID: 1713294

    Description: epitope description:T62, K64, R86, Y88, R115, F136, G138, F140 antigen name:Thyrotropin receptor host organism:Mus musculus antibody name:1H7

    Publication: 15319453;

  40. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1713295

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-809, MA-811, MA-813, MA-825

    Publication: 10611069;

  41. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1713297

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-809

    Publication: 10611069;

  42. Delineation of the discontinuous-conformational epitope of a monoclonal antibody displaying full in vitro and in vivo thyrotropin activity.

    ID: 1713301

    Description: epitope description:T62, K64, I66, R86, Y88, I91,H111, E113, R115 antigen name:Thyrotropin receptor host organism:Mus musculus NMRI

    Publication: 15319453;

  43. Detailed analysis of the region 9-30 of rat follicle stimulating hormone receptor: identification of peptide 20-30 as a potential hormone binding inhi...

    ID: 1713381

    Description: epitope description:SNRVFLCQDSK antigen name:Follicle-stimulating hormone receptor host organism:Oryctolagus cuniculus

    Publication: 16870304;

  44. Autoimmune disease of the ovary induced by a ZP3 peptide from the mouse zona pellucida.

    ID: 1713384

    Description: epitope description:EKSAPTFHLGEVAH antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 1370297;

  45. Autoimmune disease of the ovary induced by a ZP3 peptide from the mouse zona pellucida.

    ID: 1713385

    Description: epitope description:LFVDHCVATPS antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 1370297;

  46. A monoclonal antibody to human SP-10 inhibits in vitro the binding of human sperm to hamster oolemma but not to human Zona pellucida.

    ID: 1713475

    Description: epitope description:SGEQPSDEQPSGEHG antigen name:Acrosomal protein SP-10 host organism:Mus musculus BALB/c antibody name:mAb pep-SP10

    Publication: 10775167;

  47. Autoimmune disease of the ovary induced by a ZP3 peptide from the mouse zona pellucida.

    ID: 1713508

    Description: epitope description:CSNSSSSQFQIHGPR antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 1370297;

  48. Epitope recognition patterns of thyroid peroxidase autoantibodies in healthy individuals and patients with Hashimoto's thyroiditis*.

    ID: 1713517

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

    Publication: 18363888;

  49. Major autoantigenic sites of the (U1) small nuclear ribonucleoprotein-specific 68-kDa protein.

    ID: 1713539

    Description: epitope description:RREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHS antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 1697098;

  50. Protein prime-peptide boost as a new strategy induced an Eppin dominant B-cell epitope specific immune response and suppressed fertility.

    ID: 1713575

    Description: epitope description:NNNFQSKANCLN antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 19041353;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston