Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Part II: influence of dimerization of a modified GnRH-I peptide sequence on a male antifertility vaccine.

    ID: 1712178

    Description: epitope description:HWSYGLRPG antigen name:Progonadoliberin-1 host organism:Rattus norvegicus Sprague-Dawley

    Publication: 12607773;

  2. Gonadotrophin releasing hormone-based vaccine, an effective candidate for prostate cancer and other hormone-sensitive neoplasms.

    ID: 1712181

    Description: epitope description:QHWSYPLRPG host organism:Canis familiaris beagle

    Publication: 18497085;

  3. Gonadotrophin releasing hormone-based vaccine, an effective candidate for prostate cancer and other hormone-sensitive neoplasms.

    ID: 1712189

    Description: epitope description:QHWSYPLRPG host organism:Rattus norvegicus Copenhagen

    Publication: 18497085;

  4. Immunological characterization of an immunomodulatory epitope in S-antigen/arrestin with a sequence motif common to tumor necrosis factor alpha.

    ID: 1712216

    Description: epitope description:NGVELRD antigen name:Tumor necrosis factor host organism:Mus musculus BALB/c antibody name:S2DS, S7D6, S6H8, S8D8, S8D1

    Publication: 1379981;

  5. Conformation and topology of amyloid beta-protein adsorbed on a tethered artificial membrane probed by surface plasmon field-enhanced fluorescence spe...

    ID: 1712286

    Description: epitope description:DAEFRHDSGYEVHHQKL antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

    Publication: 19576283;

  6. Generation and characterization of antibodies against synthetic peptides of porcine zona pellucida ZP3 alpha.

    ID: 1712295

    Description: epitope description:ELQIAKDERYGS antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus Dutch Half Lop

    Publication: 9420858;

  7. Generation and characterization of antibodies against synthetic peptides of porcine zona pellucida ZP3 alpha.

    ID: 1712301

    Description: epitope description:CPYTGDNYQTKLI antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus Dutch Half Lop

    Publication: 9420858;

  8. Generation and characterization of antibodies against synthetic peptides of porcine zona pellucida ZP3 alpha.

    ID: 1712306

    Description: epitope description:CGTAKRVTGNQAV antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus Dutch Half Lop

    Publication: 9420858;

  9. Uveitopathogenic sites in recoverin.

    ID: 1712313

    Description: epitope description:CPSGRITRQEFQTIYSKFFPEADPKAYA antigen name:Recoverin host organism:Rattus norvegicus Lewis

    Publication: 11462170;

  10. Uveitopathogenic sites in recoverin.

    ID: 1712331

    Description: epitope description:FFGKKDDDKLTEKEFIEGTLANKEILRL antigen name:Recoverin host organism:Rattus norvegicus Lewis

    Publication: 11462170;

  11. Uveitopathogenic sites in recoverin.

    ID: 1712334

    Description: epitope description:TLANKEILRLIQFEPQKVKEKLKEKKL antigen name:Recoverin host organism:Rattus norvegicus Lewis

    Publication: 11462170;

  12. Uveitopathogenic sites in recoverin.

    ID: 1712337

    Description: epitope description:FPEADPKAYAQHVFRSFDANNDGTLDFKE antigen name:Recoverin host organism:Rattus norvegicus Lewis

    Publication: 11462170;

  13. Specificity of T and B cell responses to bovine rhodopsin in Lewis rats.

    ID: 1712432

    Description: epitope description:GWSRYIPEGMQCSCGIDYYTPHEETNNES antigen name:Rhodopsin host organism:Rattus norvegicus Lewis

    Publication: 1913836;

  14. Peripheral expression of rod photoreceptor arrestin induces an epitope-specific, protective response against experimental autoimmune uveoretinitis.

    ID: 1712459

    Description: epitope description:TSSEVATEVPFRLMHPQPED antigen name:S-arrestin host organism:Rattus norvegicus Lewis

    Publication: 16020282;

  15. Anti-peptide antibodies to the P4502D subfamily in rat, dog and man.

    ID: 1712493

    Description: epitope description:DPAQPPRD antigen name:Cytochrome P450 2D26 host organism:Oryctolagus cuniculus Japanese white

    Publication: 8578766;

  16. Anti-peptide antibodies to the P4502D subfamily in rat, dog and man.

    ID: 1712496

    Description: epitope description:DPAQPPRD antigen name:Cytochrome P450 2D18 host organism:Oryctolagus cuniculus Japanese white

    Publication: 8578766;

  17. Anti-peptide antibodies to the P4502D subfamily in rat, dog and man.

    ID: 1712498

    Description: epitope description:DPAQPPRD antigen name:Cytochrome P450 2D18 host organism:Oryctolagus cuniculus Japanese white

    Publication: 8578766;

  18. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1712503

    Description: epitope description:DAPDTDWCDSIP antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-809, MA-811, MA-813, MA...

    Publication: 10611069;

  19. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1712511

    Description: epitope description:DAPDTDWCDSIP antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-809, MA-811, MA-813, MA...

    Publication: 10611069;

  20. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1712527

    Description: epitope description:GDRAVYENELVA antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-410

    Publication: 10611069;

  21. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1712530

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-809, MA-811, MA-813, MA-825

    Publication: 10611069;

  22. Design and evaluation of a ZP3 peptide vaccine in a homologous primate model.

    ID: 1712590

    Description: epitope description:SFSKASNSWFPVEGPADICQ antigen name:marmosets protein host organism:marmosets

    Publication: 10321806;

  23. Immunocontraceptive potential of major antigenic determinants of chicken riboflavin carrier protein in the female rat.

    ID: 1712876

    Description: epitope description:YGCLEGDTHKANPSPEPNMHEC antigen name:Riboflavin-binding protein host organism:Oryctolagus cuniculus albino

    Publication: 11137254;

  24. Mapping the binding sites of anti-BP180 immunoglobulin E autoantibodies in bullous pemphigoid.

    ID: 1712882

    Description: epitope description:RSILPYGDSMDRIE antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 16117787;

  25. Mapping the binding sites of anti-BP180 immunoglobulin E autoantibodies in bullous pemphigoid.

    ID: 1712888

    Description: epitope description:EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGAD antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 16117787;

  26. Mapping the binding sites of anti-BP180 immunoglobulin E autoantibodies in bullous pemphigoid.

    ID: 1712891

    Description: epitope description:KDRLQGMAPAAGAD antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 16117787;

  27. Proportion of antibodies to the A and B immunodominant regions of thyroid peroxidase in Graves and Hashimoto disease.

    ID: 1712893

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

    Publication: 15497454;

  28. Immunocontraceptive potential of major antigenic determinants of chicken riboflavin carrier protein in the female rat.

    ID: 1712903

    Description: epitope description:YGCLEGDTHKANPSPEPNMHEC antigen name:Riboflavin-binding protein host organism:Rattus norvegicus Wistar

    Publication: 11137254;

  29. LKM-1 autoantibodies recognize a short linear sequence in P450IID6, a cytochrome P-450 monooxygenase.

    ID: 1712921

    Description: epitope description:LTEAFLAEMEKAKGN antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 1717511;

  30. Cross-reactivity of a monoclonal antibody to the amino terminal region of thyrotropin receptor with the serum protein alpha(1)-antitrypsin.

    ID: 1712932

    Description: epitope description:VCTPKSDEFNPCEDIMGYK antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 antibody name:A7

    Publication: 12193299;

  31. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712941

    Description: epitope description:AVLNEQVKE antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  32. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712943

    Description: epitope description:LNEQVKEAE antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  33. Epitope mapping of anti-rhodopsin antibodies from patients with normal pressure glaucoma.

    ID: 1712945

    Description: epitope description:YTSLHGYFVFGPTGCNLEGF antigen name:Rhodopsin host organism:Homo sapiens

    Publication: 10235565;

  34. Epitope mapping of anti-rhodopsin antibodies from patients with normal pressure glaucoma.

    ID: 1712947

    Description: epitope description:KEAAAQQQESATTQKAEKEVTR antigen name:Rhodopsin host organism:Homo sapiens

    Publication: 10235565;

  35. Epitope mapping of anti-rhodopsin antibodies from patients with normal pressure glaucoma.

    ID: 1712950

    Description: epitope description:VSKTETSQVAPA antigen name:Rhodopsin host organism:Homo sapiens

    Publication: 10235565;

  36. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712951

    Description: epitope description:NEQVKEAEG antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  37. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712955

    Description: epitope description:KEAEGSSEY antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  38. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712957

    Description: epitope description:AEGSSEYKK antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  39. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712960

    Description: epitope description:SSEYKKEIE antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  40. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712972

    Description: epitope description:KELLPEIRE antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  41. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712973

    Description: epitope description:ELLPEIREK antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  42. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712980

    Description: epitope description:EKIEDAKES antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  43. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712981

    Description: epitope description:KIEDAKESQ antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  44. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712982

    Description: epitope description:IEDAKESQR antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  45. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1712984

    Description: epitope description:DAKESQRSG antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  46. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1713001

    Description: epitope description:VAELALKAT antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  47. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1713002

    Description: epitope description:AELALKATL antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  48. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1713003

    Description: epitope description:ELALKATLV antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  49. Analysis of the autoimmune epitopes on human testicular NASP using recombinant and synthetic peptides.

    ID: 1713007

    Description: epitope description:KATLVESST antigen name:Nuclear autoantigenic sperm protein (UniProt:P49321) host organism:Homo sapiens

    Publication: 10931132;

  50. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763898

    Description: epitope description:DVSLKKVIWKDGVSFVGVGAD antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston