Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764146

    Description: epitope description:FRVTCKDIQRIPSLPPSTQT antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  2. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764148

    Description: epitope description:FRVTCKDIQRIPSLPPSTQT antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  3. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764151

    Description: epitope description:PSTQTLKLIETHLRTIPSHA antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  4. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764152

    Description: epitope description:IPSHAFSNLPNISRIYVSID antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  5. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764154

    Description: epitope description:IPSHAFSNLPNISRIYVSID antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  6. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764156

    Description: epitope description:YVSIDVTLQQLESHSFYNLS antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  7. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764158

    Description: epitope description:FYNLSKVTHIEIRNTRNLTY antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  8. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764167

    Description: epitope description:PDLTKVYSTDIFFILEITDN antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  9. The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

    ID: 1764170

    Description: epitope description:EITDNPYMTSIPVNAFQGLC antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 12697676;

  10. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755313

    Description: epitope description:GWGQLFQ host organism:Homo sapiens

    Publication: 10706737;

  11. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755314

    Description: epitope description:HYHRPPE host organism:Homo sapiens

    Publication: 10706737;

  12. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755321

    Description: epitope description:SAPWPPT host organism:Homo sapiens

    Publication: 10706737;

  13. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755326

    Description: epitope description:AMDPPYS host organism:Homo sapiens

    Publication: 10706737;

  14. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755328

    Description: epitope description:FPKNSTV host organism:Homo sapiens

    Publication: 10706737;

  15. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755341

    Description: epitope description:MHSPSTQ host organism:Homo sapiens

    Publication: 10706737;

  16. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755358

    Description: epitope description:ESMPALS host organism:Homo sapiens

    Publication: 10706737;

  17. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755360

    Description: epitope description:KWSFTPP host organism:Homo sapiens

    Publication: 10706737;

  18. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755364

    Description: epitope description:LPYKLTQ host organism:Homo sapiens

    Publication: 10706737;

  19. Epitope recognition patterns of thyroid peroxidase autoantibodies in healthy individuals and patients with Hashimoto's thyroiditis*.

    ID: 1760563

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibod...

    Publication: 18363888;

  20. Cicatricial pemphigoid: IgA and IgG autoantibodies target epitopes on both intra- and extracellular domains of bullous pemphigoid antigen 180.

    ID: 1760573

    Description: epitope description:ADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGIS antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 11736901;

  21. Induction of autoimmune thyroiditis and hypothyroidism by immunization of immunoactive T cell epitope of thyroid peroxidase.

    ID: 1760605

    Description: epitope description:QGQLMNEELTERLFVLSNVG antigen name:Thyroid peroxidase host organism:Mus musculus C57BL/6

    Publication: 16527849;

  22. Immune recognition of hormonogenic sites of human thyroglobulin: studies of Graves' sera and a murine monoclonal antibody with thyroid hormone antibod...

    ID: 1760628

    Description: epitope description:EHSTDDYASFSR antigen name:Thyroglobulin host organism:Homo sapiens

    Publication: 7522798;

  23. Immune recognition of hormonogenic sites of human thyroglobulin: studies of Graves' sera and a murine monoclonal antibody with thyroid hormone antibod...

    ID: 1760630

    Description: epitope description:HAPENYGHGSLE antigen name:Thyroglobulin host organism:Homo sapiens

    Publication: 7522798;

  24. Unique autoantibody epitopes in an immunodominant region of thyroid peroxidase.

    ID: 1760654

    Description: epitope description:NEWREFCGLPRLETPADLSTAI antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

    Publication: 8617771;

  25. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760688

    Description: epitope description:EKTPVKKKARKSAGAA antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

    Publication: 7935495;

  26. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760689

    Description: epitope description:EKTPVKKKARKSAGAA antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  27. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760700

    Description: epitope description:VSELITKAVAASKERS antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

    Publication: 7935495;

  28. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760702

    Description: epitope description:VSELITKAVAASKERS antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  29. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760705

    Description: epitope description:RSGVSLAALKKALAAA antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

    Publication: 7935495;

  30. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760707

    Description: epitope description:RSGVSLAALKKALAAA antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  31. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760714

    Description: epitope description:IKLGLKSLVSKGTLVQ antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  32. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760722

    Description: epitope description:LVQTKGTGASGSFKLN antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  33. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760727

    Description: epitope description:KLNKKAASGEAKPKAK antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  34. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760729

    Description: epitope description:AKKAGAAKAKKPAGAA antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  35. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760731

    Description: epitope description:AKKAGAAKAKKPAGAA antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  36. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760732

    Description: epitope description:AKKAGAAKAKKPAGAA antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  37. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760766

    Description: epitope description:KPKAAKPKKAAAKKK antigen name:Histone H1.4 host organism:Homo sapiens

    Publication: 7935495;

  38. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760768

    Description: epitope description:KSPKKAKAAKPKKAPK antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

    Publication: 7935495;

  39. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760772

    Description: epitope description:KLNKKAASGEAKPKAK antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

    Publication: 7935495;

  40. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760783

    Description: epitope description:TESLVLSPAPAKPKRVKASRRSASHPTYSEM antigen name:Histone H5 host organism:Oryctolagus cuniculus

    Publication: 7935495;

  41. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760784

    Description: epitope description:TESLVLSPAPAKPKRVKASRRSASHPTYSEM antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7935495;

  42. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760787

    Description: epitope description:KSRKASKAKKVKRSK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7935495;

  43. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760788

    Description: epitope description:KSRKASKAKKVKRSK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7935495;

  44. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760799

    Description: epitope description:KEIKKVATPKKASKPKK antigen name:Histone H1.0 host organism:Homo sapiens

    Publication: 7935495;

  45. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760800

    Description: epitope description:KEIKKVATPKKASKPKK antigen name:Histone H1.0 host organism:Homo sapiens

    Publication: 7935495;

  46. Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

    ID: 1760802

    Description: epitope description:KEIKKVATPKKASKPKK antigen name:Histone H1.0 host organism:Homo sapiens

    Publication: 7935495;

  47. Increased receptor binding by bovine (b) TSH bound to monoclonal antibody to bTSHbeta-subunit.

    ID: 1760812

    Description: epitope description:LPK antigen name:Thyrotropin subunit beta host organism:Mus musculus antibody name:MoAb No.1

    Publication: 18202525;

  48. Increased receptor binding by bovine (b) TSH bound to monoclonal antibody to bTSHbeta-subunit.

    ID: 1760820

    Description: epitope description:PKYA antigen name:Thyrotropin subunit beta host organism:Mus musculus antibody name:MoAb No.3

    Publication: 18202525;

  49. Profile of the regions of acetylcholine receptor alpha chain recognized by T-lymphocytes and by antibodies in EAMG-susceptible and non-susceptible mou...

    ID: 1760826

    Description: epitope description:FAIVHMTKLLLDYTGK antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus SJL

    Publication: 7519305;

  50. Profile of the regions of acetylcholine receptor alpha chain recognized by T-lymphocytes and by antibodies in EAMG-susceptible and non-susceptible mou...

    ID: 1760828

    Description: epitope description:LGIWTYDGTKVSISPES antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus SJL

    Publication: 7519305;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston