Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19206

    Description: epitope description:AGHVDALGISYNQLDK antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  2. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19214

    Description: epitope description:LDADTLYSVVSFSAGS antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  3. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19215

    Description: epitope description:LDADTLYSVVSFSAGS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  4. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19217

    Description: epitope description:LDADTLYSVVSFSAGS antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  5. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19220

    Description: epitope description:VVSFSAGSAIDRGAVS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  6. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19221

    Description: epitope description:VVSFSAGSAIDRGAVS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  7. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19224

    Description: epitope description:AIDRGAVSDAADKFRV antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  8. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19229

    Description: epitope description:DAADKFRVMMFGGAPA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  9. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19239

    Description: epitope description:GQEKTAEPEHEAATPS antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  10. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19240

    Description: epitope description:GQEKTAEPEHEAATPS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  11. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19241

    Description: epitope description:GQEKTAEPEHEAATPS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  12. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19246

    Description: epitope description:EHEAATPSASSVPSTV antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  13. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19247

    Description: epitope description:EHEAATPSASSVPSTV antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  14. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19255

    Description: epitope description:HGKVVDAVDRAKEAAK antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  15. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19259

    Description: epitope description:DRAKEAAKQAYAGVRK antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  16. Chemical chaperones enhance superantigen and conventional antigen presentation by HLA-DM-deficient as well as HLA-DM-sufficient antigen-presenting cel...

    ID: 1032229

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Mus musculus C57BL/6

    Publication: 9759841;

  17. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032265

    Description: epitope description:VEQLTGHGSSVLEELVQLVKDKNIDISIKY antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  18. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032271

    Description: epitope description:DKNIDISIKYDPRKDSEVFANRVITDDIEL antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  19. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032281

    Description: epitope description:VKEFLESSPNTQWELRAFMAVMHFSLTADR antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  20. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032285

    Description: epitope description:VMHFSLTADRIDDDILKVIVDSMNHHGDAR antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston