Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1763122

    Description: epitope description:FTIADPDD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  2. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1763134

    Description: epitope description:DMCGFDTG antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  3. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1763136

    Description: epitope description:CGFDTGAL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  4. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763177

    Description: epitope description:PSTQTLKLIETHLRTIPSHA antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  5. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763182

    Description: epitope description:YVSIDVTLQQLESHSFYNLS antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  6. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763187

    Description: epitope description:LLKFLGIFNTGLKMFPDLTK antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  7. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763193

    Description: epitope description:FQGLCNETLTLKLYNNGFTS antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  8. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763196

    Description: epitope description:NGFTSVQGYAFNGTKLDAVY antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  9. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763197

    Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  10. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763201

    Description: epitope description:DVSQTSVTALPSKGLEHLKE antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  11. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763209

    Description: epitope description:IRGILESLMCNESSMQSLRQ antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  12. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763218

    Description: epitope description:YYVFFEEQEDEIIGFGQELK antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  13. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763222

    Description: epitope description:DSHYDYTICGDSEDMVCTPK antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  14. Identification of thyroid blocking antibodies and receptor epitopes in autoimmune hypothyroidism by affinity purification using synthetic TSH receptor...

    ID: 1763227

    Description: epitope description:SSYAKVSICLPMDTETPLAL antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 8722576;

  15. Protection of mice against influenza A virus challenge by vaccination with baculovirus-expressed M2 protein.

    ID: 1763699

    Description: epitope description:SLLTEVETPIRNEWGCR antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 8578816;

  16. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1763716

    Description: epitope description:AFRGHIAREEAKK antigen name:Sperm surface protein Sp17 host organism:Homo sapiens

    Publication: 9022615;

  17. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763767

    Description: epitope description:LDAMPAGNPAFPVIPG antigen name:Outer membrane protein B host organism:Oryctolagus cuniculus

    Publication: 11994474;

  18. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763770

    Description: epitope description:FPVIPGINIEQKNACS antigen name:Outer membrane protein B host organism:Oryctolagus cuniculus

    Publication: 11994474;

  19. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763781

    Description: epitope description:TSEPLNSESEVTDGMIEVQS antigen name:Outer membrane protein B host organism:Oryctolagus cuniculus

    Publication: 11994474;

  20. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763797

    Description: epitope description:QKNACSFDLCNSYDVL antigen name:Outer membrane protein B host organism:Homo sapiens

    Publication: 11994474;

  21. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763806

    Description: epitope description:QYYRLPMNAYRDFTSEPLNS antigen name:Outer membrane protein B host organism:Homo sapiens

    Publication: 11994474;

  22. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763824

    Description: epitope description:QKNACSFDLCNSYDVL antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  23. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763827

    Description: epitope description:YIFSEEAQVKDVPVVT antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  24. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763828

    Description: epitope description:DVPVVTSVTTAGVGPSPDIT antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  25. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763830

    Description: epitope description:DLVNCNLNTNCVAVAFSLPD antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  26. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763832

    Description: epitope description:FDVSFEVKVGGLKQYYRLP antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  27. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763833

    Description: epitope description:QYYRLPMNAYRDFTSEPLNS antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  28. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763836

    Description: epitope description:DVSLKKVIWKDGVSFVGVGAD antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  29. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763837

    Description: epitope description:FVGVGADYRHASCPIDYIIA antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  30. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763842

    Description: epitope description:APDDSFKKLEDRFTNLKF antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  31. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763854

    Description: epitope description:NSYDVLSALSGNLKL antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  32. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763855

    Description: epitope description:GNLKLCFCGDYIFSEE antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  33. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763861

    Description: epitope description:FDVSFEVKVGGLKQYYRLP antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  34. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763874

    Description: epitope description:NYVADNFFYNVEGRWGSQ antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  35. Towards an antigenic map of human thyroglobulin: identification of ten epitope-bearing sequences within the primary structure of thyroglobulin.

    ID: 1763882

    Description: epitope description:AGSGLREDLLSLQEPGSKTYSK antigen name:Thyroglobulin host organism:Oryctolagus cuniculus antibody name:r0,r1,r<...

    Publication: 2475565;

  36. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763893

    Description: epitope description:AFSLPDRSLSAIPLFDVSFE antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  37. Antigenic topology of chlamydial PorB protein and identification of targets for immune neutralization of infectivity.

    ID: 1763897

    Description: epitope description:GMIEVQSNYGFVWDVSLKKV antigen name:Outer membrane protein B host organism:Mus musculus Swiss Webster

    Publication: 11994474;

  38. A potent erythropoietin-mimicking human antibody interacts through a novel binding site.

    ID: 1716812

    Description: epitope description:E49, L50, W88, E121, R123, P131, H134, R135, V136, H138 antigen name:Erythropoietin receptor host organism:Mus musculus Xenomouse ...

    Publication: 17620453;

  39. A potent erythropoietin-mimicking human antibody interacts through a novel binding site.

    ID: 1716814

    Description: epitope description:E49, L50, W88, E121, R123, P131, H134, R135, V136, H138 antigen name:Erythropoietin receptor host organism:Mus musculus Xenomouse ...

    Publication: 17620453;

  40. LKM-1 sera from autoimmune hepatitis patients that recognize ERp57, carboxylesterase 1 and CYP2D6.

    ID: 1716845

    Description: epitope description:IFRDGEEAGAYDGPRTADGIVSHLK antigen name:Protein disulfide-isomerase A3 host organism:Homo sapiens

    Publication: 20208391;

  41. LKM-1 sera from autoimmune hepatitis patients that recognize ERp57, carboxylesterase 1 and CYP2D6.

    ID: 1716848

    Description: epitope description:EHIEL antigen name:Liver carboxylesterase 1 host organism:Homo sapiens

    Publication: 20208391;

  42. Immunogenicity and contraceptive potential of a human zona pellucida 3 peptide vaccine.

    ID: 1716852

    Description: epitope description:RRQPHVMS antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus C57BL/6 HLA-DR3 Tg

    Publication: 9047023;

  43. Mouse vaccination with dendritic cells loaded with prion protein peptides overcomes tolerance and delays scrapie.

    ID: 1716902

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19864503;

  44. Mouse vaccination with dendritic cells loaded with prion protein peptides overcomes tolerance and delays scrapie.

    ID: 1716904

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19864503;

  45. Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.

    ID: 1716944

    Description: epitope description:L14, M15, I16, S17, R18, N147, G148, S187, M191, H196, N197, H198, Y199, Q201, S203 antigen name:Immunoglobulin host organism:Homo...

    Publication: 9145108;

  46. Characterization of IgE epitopes of Cuc m 2, the major melon allergen, and their role in cross-reactivity with pollen profilins.

    ID: 1716957

    Description: epitope description:KGWMAYPVASSW host organism:Homo sapiens

    Publication: 20205701;

  47. Characterization of IgE epitopes of Cuc m 2, the major melon allergen, and their role in cross-reactivity with pollen profilins.

    ID: 1716961

    Description: epitope description:TARNETPAMRMN host organism:Homo sapiens

    Publication: 20205701;

  48. Characterization of IgE epitopes of Cuc m 2, the major melon allergen, and their role in cross-reactivity with pollen profilins.

    ID: 1716964

    Description: epitope description:THPVTDPIAHPP host organism:Homo sapiens

    Publication: 20205701;

  49. Thyroperoxidase, but not the thyrotropin receptor, contains sequential epitopes recognized by autoantibodies in recombinant peptides expressed in the ...

    ID: 1717036

    Description: epitope description:DNTGLTRVPMDAFQVGKFPEDFESCD antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

    Publication: 1716261;

  50. Anaphylaxis to Patent Blue V. II. A unique IgE-mediated reaction.

    ID: 1717045

    Description: epitope description:patent blue V host organism:Mus musculus

    Publication: 19804438;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston