Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487351

    Description: epitope description:ENKGTRIRFK antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  2. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487357

    Description: epitope description:MPTAQSTMKA antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  3. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487358

    Description: epitope description:STMKAEELTP antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  4. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487359

    Description: epitope description:EELTPGRFRT antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  5. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487365

    Description: epitope description:MSPVMGVIGF antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  6. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487368

    Description: epitope description:VKPGTPAQEI antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  7. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487374

    Description: epitope description:DKLIDYAASG antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  8. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487375

    Description: epitope description:YAASGDPTSP antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  9. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487379

    Description: epitope description:PDRCPPTCIY antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  10. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487380

    Description: epitope description:PTCIYVAGMA antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  11. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487387

    Description: epitope description:EEKLKKKSSF antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  12. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487389

    Description: epitope description:YQSYLRRTQS antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  13. Production of monospecific antibody to immunodominant epitopes of the caprine arthritis encephalitis virus transmembrane glycoprotein and analysis of ...

    ID: 1487401

    Description: epitope description:CTWQQWERELQGYD antigen name:envelope polyprotein host organism:Capra hircus

    Publication: 12403923;

  14. Neutralization of foot-and-mouth disease virus can be mediated through any of at least three separate antigenic sites.

    ID: 1487406

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus antibody name:B2, D9

    Publication: 2438378;

  15. Potentiation of immune response against the RESA peptides of Plasmodium falciparum by incorporating a universal T-cell epitope (CS.T3) and an immunomo...

    ID: 1487413

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 10480553;

  16. Potentiation of immune response against the RESA peptides of Plasmodium falciparum by incorporating a universal T-cell epitope (CS.T3) and an immunomo...

    ID: 1487414

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus FVB/J antibody name:Mouse sera

    Publication: 10480553;

  17. Potentiation of immune response against the RESA peptides of Plasmodium falciparum by incorporating a universal T-cell epitope (CS.T3) and an immunomo...

    ID: 1487416

    Description: epitope description:DDEHVEEPTVADDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Mus musculus FVB/J antibody name:Mouse sera

    Publication: 10480553;

  18. Specificities of monoclonal antibodies to domain I of alpha-gliadins.

    ID: 1487417

    Description: epitope description:QQQP antigen name:Tri a 21 host organism:Mus musculus BALB/c antibody name:WC2

    Publication: 8446845;

  19. Peptide mimotopes of complex carbohydrates in Salmonella enterica serovar typhi which react with both carbohydrate-specific monoclonal antibody and po...

    ID: 1487423

    Description: epitope description:ENHSPVNIAHKL host organism:Mus musculus antibody name:ATVi

    Publication: 18037781;

  20. Neutralization sites of type O1 foot-and-mouth disease virus defined by monoclonal antibodies and neutralization-escape virus variants.

    ID: 1487437

    Description: epitope description:L868, L872 antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:13DD2.1.1

    Publication: 2827379;

  21. The major subunit ClpG of Escherichia coli CS31A fibrillae as an expression vector for different combinations of two TGEV coronavirus epitopes.

    ID: 1487469

    Description: epitope description:TFTNPVVSTTQWSAP antigen name:Other Escherichia coli protein host organism:Oryctolagus cuniculus

    Publication: 8972902;

  22. Monoclonal antibody epitope mapping describes tailspike beta-helix folding and aggregation intermediates.

    ID: 1487473

    Description: epitope description:K164, W203, D239, G245, V332 antigen name:Tail fiber protein host organism:Mus musculus BALB/c antibody name:Abs 33, 175 and 236

    Publication: 15833745;

  23. Characterization of a monoclonal antibody specific for HMW subunits of glutenin and its use to investigate glutenin polymers.

    ID: 1487474

    Description: epitope description:SVTCPQQV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody name:IFRN 1...

    Publication: 10725123;

  24. Characterization of a monoclonal antibody specific for HMW subunits of glutenin and its use to investigate glutenin polymers.

    ID: 1487477

    Description: epitope description:SVTCPQQV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody name:IFRN 1...

    Publication: 10725123;

  25. Four major antigenic sites of the coronavirus transmissible gastroenteritis virus are located on the amino-terminal half of spike glycoprotein S.

    ID: 1487502

    Description: epitope description:SSFFSYGEI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:3b.5

    Publication: 1693663;

  26. Architecture of physalis mottle tymovirus as probed by monoclonal antibodies and cross-linking studies.

    ID: 1487530

    Description: epitope description:SQPNTEQSPAIVLPF antigen name:coat protein host organism:Mus musculus BALB/c antibody name:PA3B2

    Publication: 8460497;

  27. Architecture of physalis mottle tymovirus as probed by monoclonal antibodies and cross-linking studies.

    ID: 1487531

    Description: epitope description:SQPNTEQSPAIVLPF antigen name:coat protein host organism:Mus musculus BALB/c antibody name:PA3B2

    Publication: 8460497;

  28. The last two cytoplasmic loops in the lactose permease of Escherichia coli comprise a discontinuous epitope for a monoclonal antibody.

    ID: 1487535

    Description: epitope description:I283, K289, F334, K335, E342, V343, R344, F345 antigen name:Lactose permease host organism:Mus musculus BALB/c antibody name:4B11

    Publication: 8993344;

  29. Antigenic sites on foot-and-mouth disease virus type A10.

    ID: 1487543

    Description: epitope description:D70 antigen name:Genome polyprotein host organism:Mus musculus antibody name:mAb3.10

    Publication: 2455819;

  30. Identification of virus neutralizing epitopes on naturally occurring variants of type A12 foot-and-mouth disease virus.

    ID: 1487582

    Description: epitope description:LAPRVAR antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7SF3, 6HE4

    Publication: 2483013;

  31. Identification of neutralizing antigenic sites on VP1 and VP2 of type A5 foot-and-mouth disease virus, defined by neutralization-resistant variants.

    ID: 1487592

    Description: epitope description:D141 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:23FB4, 23MF4, 23OG2

    Publication: 1707983;

  32. Identification of neutralizing antigenic sites on VP1 and VP2 of type A5 foot-and-mouth disease virus, defined by neutralization-resistant variants.

    ID: 1487593

    Description: epitope description:D706 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:23HA6

    Publication: 1707983;

  33. Identification of neutralizing antigenic sites on VP1 and VP2 of type A5 foot-and-mouth disease virus, defined by neutralization-resistant variants.

    ID: 1487594

    Description: epitope description:D706 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:23HA6

    Publication: 1707983;

  34. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487601

    Description: epitope description:SRISQAVLPAGT antigen name:Coat protein host organism:Dicentrarchus labrax

    Publication: 17584439;

  35. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487605

    Description: epitope description:RYAVETLEFEIQ antigen name:Coat protein host organism:Dicentrarchus labrax

    Publication: 17584439;

  36. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487607

    Description: epitope description:GGYVAGFLPDPT antigen name:Coat protein host organism:Dicentrarchus labrax

    Publication: 17584439;

  37. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487609

    Description: epitope description:LQATRGAVVAKW antigen name:Coat protein host organism:Dicentrarchus labrax

    Publication: 17584439;

  38. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487630

    Description: epitope description:WDNFNKTFTDGV antigen name:Coat protein host organism:Dicentrarchus labrax

    Publication: 17584439;

  39. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487649

    Description: epitope description:KWWESRTVRPQY antigen name:Coat protein host organism:Mus musculus BALB/c antibody name:4C3, 4A12, 5G10

    Publication: 17584439;

  40. Identification of B-cell epitopes on the betanodavirus capsid protein.

    ID: 1487653

    Description: epitope description:NTDVVNVSVLCR antigen name:Coat protein host organism:Mus musculus BALB/c antibody name:4C3, 3B10, 4A12,5G10

    Publication: 17584439;

  41. Use of monoclonal antibodies to identify four neutralization immunogens on a common cold picornavirus, human rhinovirus 14.

    ID: 1487659

    Description: epitope description:D658, E662 antigen name:Genome polyprotein host organism:Mus musculus antibody name:17, 27, 34, 11, 15, 19, 23, 12, 14, 20

    Publication: 2416951;

  42. Use of monoclonal antibodies to identify four neutralization immunogens on a common cold picornavirus, human rhinovirus 14.

    ID: 1487669

    Description: epitope description:Q650, K652, D705, S706 antigen name:Genome polyprotein host organism:Mus musculus antibody name:13, 26, 29, 30, 32

    Publication: 2416951;

  43. Use of monoclonal antibodies to identify four neutralization immunogens on a common cold picornavirus, human rhinovirus 14.

    ID: 1487670

    Description: epitope description:E205, S227, A228, E230, V231, E777 antigen name:Genome polyprotein host organism:Mus musculus antibody name:16, 18, 28, 35

    Publication: 2416951;

  44. Use of monoclonal antibodies to identify four neutralization immunogens on a common cold picornavirus, human rhinovirus 14.

    ID: 1487671

    Description: epitope description:N403, R406, E409, G534, K854 antigen name:Genome polyprotein host organism:Mus musculus antibody name:21, 22, 24, 33, 25, 31

    Publication: 2416951;

  45. Antigenic properties and population stability of a foot-and-mouth disease virus with an altered Arg-Gly-Asp receptor-recognition motif.

    ID: 1487680

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10466785;

  46. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487710

    Description: epitope description:EALYGMS host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  47. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487711

    Description: epitope description:SPTRAVNELFGM host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  48. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487713

    Description: epitope description:YVGPLTQTLYGM host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  49. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489867

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:E3

    Publication: 18480437;

  50. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489868

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  51. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489869

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  52. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489870

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:E3

    Publication: 18480437;

  53. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489872

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  54. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489873

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  55. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1489877

    Description: epitope description:NMMRFTSQPPNN host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  56. Identification of a conserved linear B-cell epitope at the N-terminus of the E2 glycoprotein of Classical swine fever virus by phage-displayed random ...

    ID: 1489878

    Description: epitope description:FDGTNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:HQ06

    Publication: 18485511;

  57. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489882

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  58. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489883

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  59. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489890

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:E3

    Publication: 18480437;

  60. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489891

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  61. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489892

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  62. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489895

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  63. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489896

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  64. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489897

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  65. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1489912

    Description: epitope description:NMMRFTELSTPS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  66. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489916

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  67. Immunogold electron microscopic localization of the 2 EF-hand calcium-binding pollen allergen Phl p 7 and its homologues in pollens of grasses, weeds ...

    ID: 1491179

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 18204277;

  68. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491186

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  69. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491193

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  70. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491214

    Description: epitope description:ASQASNVFQGVFLTNNMLQHDC antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  71. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491234

    Description: epitope description:YATARAGADILWDVGAKVSMKLWGL antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  72. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491237

    Description: epitope description:KKENAANVNGTVGADALLTLGYR antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  73. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491254

    Description: epitope description:QAAAAVPATKWKAEYCGYY antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  74. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491263

    Description: epitope description:GFGSSTMGGKGG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  75. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491268

    Description: epitope description:GGDLYTVTNSDD antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  76. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491275

    Description: epitope description:DPVNPAPGTLRY antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  77. Multi-epitope DNA vaccine linked to the A2/B subunit of cholera toxin protect mice against Toxoplasma gondii.

    ID: 1491292

    Description: epitope description:TCPDKKSTA antigen name:Major surface antigen host organism:Mus musculus BALB/c

    Publication: 18555564;

  78. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491297

    Description: epitope description:PMYIAGYKTFDG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  79. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491299

    Description: epitope description:AGYKTFDGRGAQ antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  80. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491328

    Description: epitope description:NGGPCVFIKRVS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  81. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491330

    Description: epitope description:CVFIKRVSNVII antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  82. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491331

    Description: epitope description:FIKRVSNVIIHG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  83. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491336

    Description: epitope description:HGLHLYGCSTSV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  84. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491339

    Description: epitope description:LYGCSTSVLGNV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  85. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491342

    Description: epitope description:SVLGNVLINESF antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  86. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491345

    Description: epitope description:LINESFGVEPVH antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  87. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491356

    Description: epitope description:EPVHPQDGDALT antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  88. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491361

    Description: epitope description:LTLRTATNIWID antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  89. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491376

    Description: epitope description:TGVTISNNLFFN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  90. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491378

    Description: epitope description:ISNNLFFNHHKV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  91. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491380

    Description: epitope description:LFFNHHKVMLLG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  92. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491382

    Description: epitope description:HHKVMLLGHDDA antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  93. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491393

    Description: epitope description:YSDDKSMKVTVA antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  94. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491394

    Description: epitope description:DDKSMKVTVAFN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  95. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491395

    Description: epitope description:KSMKVTVAFNQF antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  96. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491397

    Description: epitope description:VTVAFNQFGPNC antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  97. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491399

    Description: epitope description:FNQFGPNCGQRM antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  98. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491418

    Description: epitope description:ARYGLVHVANNN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  99. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491424

    Description: epitope description:YDPWTIYAIGGS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  100. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491425

    Description: epitope description:PWTIYAIGGSSN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston