Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491472

    Description: epitope description:NAGVLTCSLSKR antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  2. Structure-immunogenicity relationship of melittin, its transposed analogues, and D-melittin.

    ID: 1491488

    Description: epitope description:GIGAVLKVLTTGLPALISWIKRKRQQ antigen name:Api m 4 host organism:Mus musculus BALB/c

    Publication: 8027544;

  3. Identification of binding sites for neutralizing monoclonal antibodies on the 14-kDa fusion protein of orthopox viruses.

    ID: 1491541

    Description: epitope description:STKAAKKPEAKREAI antigen name:Protein A27 host organism:Mus musculus BALB/c antibody name:3F5

    Publication: 7513923;

  4. Candidate multi-peptide-vaccine against classical swine fever virus induced potent immunity with serological marker.

    ID: 1491553

    Description: epitope description:CKEDYRYAISSTNEIGLLGAGGLT antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 15882522;

  5. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491566

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  6. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491569

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  7. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491570

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Oryctolagus cuniculus

    Publication: 15100313;

  8. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491575

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  9. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491577

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;

  10. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491589

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston