Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "
  1. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771643

    Description: epitope description:NQSLGWGDSSKPVSS antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  2. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771644

    Description: epitope description:WGDSSKPVSSPDWNK antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  3. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771647

    Description: epitope description:EPSPESIRRKMEIDD antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  4. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771652

    Description: epitope description:SSKGLSGKKRRRERG antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  5. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771660

    Description: epitope description:GDYNRTVGKGPGSRP antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  6. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771661

    Description: epitope description:TVGKGPGSRPQISKE antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  7. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771662

    Description: epitope description:PGSRPQISKESSMER antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  8. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771663

    Description: epitope description:MFGVGNTAAQPRGMQ antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  9. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771680

    Description: epitope description:PGEPWKGYPNIDPET antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  10. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771686

    Description: epitope description:TNTSLAHELWKVPLP antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  11. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771689

    Description: epitope description:PPGLTGQKPPLSTWD antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  12. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771690

    Description: epitope description:GQKPPLSTWDNSPLR antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  13. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771697

    Description: epitope description:ALVRYSSKEEVVKAQ antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  14. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771704

    Description: epitope description:SPINAFLSVDHLGGG antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;
  15. A self T cell epitope induces autoantibody response: mechanism for production of antibodies to diverse glomerular basement membrane antigens.

    ID: 1771710

    Description: epitope description:QTTANPSCPEG antigen name:Protein LOC100911572 host organism:Rattus norvegicus Wistar Kyoto

    Publication: 15034074;
  16. The 301 to 314 amino acid residue of beta-tubulin is not a target epitope for serum IgM antibodies in chronic inflammatory demyelinating polyneuropath...

    ID: 1771749

    Description: epitope description:AACDPRHGRYLTVA antigen name:Tubulin beta-6 chain host organism:Homo sapiens

    Publication: 10223409;
  17. The 301 to 314 amino acid residue of beta-tubulin is not a target epitope for serum IgM antibodies in chronic inflammatory demyelinating polyneuropath...

    ID: 1771752

    Description: epitope description:AACDPRHGRYLTVA antigen name:Tubulin beta-6 chain host organism:Homo sapiens

    Publication: 10223409;
  18. Evaluation of the contraceptive potential of recombinant human ZP3 and human ZP3 peptides in a primate model: their safety and efficacy.

    ID: 1771764

    Description: epitope description:SQWSRSASRNRRHVTEEADV antigen name:Zona pellucida sperm-binding protein 3 host organism:Callithrix pygmaea

    Publication: 9764365;
  19. Evaluation of the contraceptive potential of recombinant human ZP3 and human ZP3 peptides in a primate model: their safety and efficacy.

    ID: 1771765

    Description: epitope description:ECQEATLMVMVSKDLFGTGK antigen name:Zona pellucida sperm-binding protein 3 host organism:Callithrix pygmaea

    Publication: 9764365;
  20. Evaluation of the contraceptive potential of recombinant human ZP3 and human ZP3 peptides in a primate model: their safety and efficacy.

    ID: 1771768

    Description: epitope description:SQWSRSASRNRRHVTEEADV antigen name:Zona pellucida sperm-binding protein 3 host organism:Callithrix pygmaea

    Publication: 9764365;
  21. Evaluation of the contraceptive potential of recombinant human ZP3 and human ZP3 peptides in a primate model: their safety and efficacy.

    ID: 1771773

    Description: epitope description:SQWSRSASRNRRHVTEEADV antigen name:Zona pellucida sperm-binding protein 3 host organism:Callithrix pygmaea

    Publication: 9764365;
  22. Human monoclonal autoantibody 2E7 is specific for a peptide sequence of platelet glycoprotein IIb. Localization of the epitope to IIb231-238 with an i...

    ID: 1771808

    Description: epitope description:NGYPDLIVGA antigen name:Integrin alpha-IIb host organism:Homo sapiens

    Publication: 1716897;
  23. Human monoclonal autoantibody 2E7 is specific for a peptide sequence of platelet glycoprotein IIb. Localization of the epitope to IIb231-238 with an i...

    ID: 1771819

    Description: epitope description:ATGHNIPQKLSLN antigen name:Integrin alpha-IIb host organism:Homo sapiens

    Publication: 1716897;
  24. Human monoclonal autoantibody 2E7 is specific for a peptide sequence of platelet glycoprotein IIb. Localization of the epitope to IIb231-238 with an i...

    ID: 1771826

    Description: epitope description:TDVNGDGRHDL antigen name:Integrin alpha-IIb host organism:Homo sapiens

    Publication: 1716897;
  25. Analysis of an epitope sequence recognized by a monoclonal antibody MAb-5H4 against a porcine zona pellucida glycoprotein (pZP4) that blocks fertiliza...

    ID: 1771836

    Description: epitope description:CTYVLDPENL antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus BALB/c antibody name:5H4

    Publication: 8568774;
  26. Analysis of an epitope sequence recognized by a monoclonal antibody MAb-5H4 against a porcine zona pellucida glycoprotein (pZP4) that blocks fertiliza...

    ID: 1771867

    Description: epitope description:CTYVLDPENLTLKAPYEA antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus ICR

    Publication: 8568774;
  27. Analysis of an epitope sequence recognized by a monoclonal antibody MAb-5H4 against a porcine zona pellucida glycoprotein (pZP4) that blocks fertiliza...

    ID: 1771868

    Description: epitope description:CTYVLDPENLTLKAPYEA antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus ICR

    Publication: 8568774;
  28. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771876

    Description: epitope description:FVQGNQRAHGQDLGT antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  29. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771877

    Description: epitope description:GQDLGTLGSCLQRFTT antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  30. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771881

    Description: epitope description:PALMPMNMAPITGRA antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  31. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771882

    Description: epitope description:APITGRALEPYISRCTVCEGPAI antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  32. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771883

    Description: epitope description:CEGPAIAIAVHSQTTD antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  33. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771884

    Description: epitope description:SQTTDIPCPHGWIS antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  34. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771885

    Description: epitope description:HGWISLWKGFSFIMF antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  35. Synthetic peptides of Goodpasture's antigen in antiglomerular basement membrane nephritis in rats.

    ID: 1771891

    Description: epitope description:SLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 12032491;
  36. Core alpha1,3-fucose is a key part of the epitope recognized by antibodies reacting against plant N-linked oligosaccharides and is present in a wide v...

    ID: 1771893

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-Gl...

    Publication: 9621106;
  37. Characterization of autoantigenic epitopes on platelet glycoprotein IIb/IIIa using random peptide libraries.

    ID: 1771903

    Description: epitope description:REKAKW host organism:Homo sapiens

    Publication: 8977249;
  38. Characterization of autoantigenic epitopes on platelet glycoprotein IIb/IIIa using random peptide libraries.

    ID: 1771904

    Description: epitope description:PVVWKN host organism:Homo sapiens

    Publication: 8977249;
  39. Characterization of autoantigenic epitopes on platelet glycoprotein IIb/IIIa using random peptide libraries.

    ID: 1771909

    Description: epitope description:REKAKW host organism:Homo sapiens

    Publication: 8977249;
  40. Carbohydrate epitopes as a cause of cross-reactivity in patients allergic to Hymenoptera venom.

    ID: 1771926

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc antigen name:N-g...

    Publication: 19562300;
  41. Hydrogen bonding and solvent structure in an antigen-antibody interface. Crystal structures and thermodynamic characterization of three Fv mutants com...

    ID: 1771931

    Description: epitope description:D36, N37, G40, Y41, S42, N45, G120, K134, G135, T136, D137, V138, Q139, I142, R143 antigen name:Gal d 4 host organism:Mus musculus...

    Publication: 8952503;
  42. Histone autoantigens in murine lupus. Definition of a major epitope within an accessible region of chromatin.

    ID: 1771936

    Description: epitope description:PEPAKSAPAPKKGSK antigen name:Histone H2B type 1-F/J/L host organism:Mus musculus NZB X NZW

    Publication: 1693638;
  43. Histone autoantigens in murine lupus. Definition of a major epitope within an accessible region of chromatin.

    ID: 1771940

    Description: epitope description:PEPAKSAPAPKKGSK antigen name:Histone H2B type 1-F/J/L host organism:Mus musculus NZB X NZW

    Publication: 1693638;
  44. Three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex.

    ID: 1771963

    Description: epitope description:R39, Y41, N121, N124, R130, K131, K134, G135, T136, D137 antigen name:Lysozyme C host organism:Mus musculus BALB/c antibody name:F...

    Publication: 8356074;
  45. Anti-heavy-chain monoclonal antibodies directed to the acidic regions of the factor VIII molecule inhibit the binding of factor VIII to phospholipids ...

    ID: 1771980

    Description: epitope description:EDISAYLL antigen name:Coagulation factor VIII host organism:Mus musculus BALB/c antibody name:F26F6

    Publication: 12958606;
  46. Antibodies to the peptide from the plasmid-coded Yersinia outer membrane protein (YOP1) in patients with ankylosing spondylitis.

    ID: 1771984

    Description: epitope description:AIGDRSKTDRENSVSIG antigen name:Other Yersinia enterocolitica protein host organism:Homo sapiens

    Publication: 2265487;
  47. Antibodies to the peptide from the plasmid-coded Yersinia outer membrane protein (YOP1) in patients with ankylosing spondylitis.

    ID: 1771989

    Description: epitope description:AIGDRSKTDRENSVSIG antigen name:Other Yersinia enterocolitica protein host organism:Homo sapiens

    Publication: 2265487;
  48. T cell lines specific for a synthetic Heymann nephritis peptide derived from the receptor-associated protein.

    ID: 1772007

    Description: epitope description:KAKRLHLSPVRLAELHSDLKIQE antigen name:Alpha-2-macroglobulin receptor-associated protein host organism:Rattus norvegicus Lewis

    Publication: 10886254;
  49. Detection of gender difference and epitope specificity of IgG antibody activity against IgA1 hinge portion in IgA nephropathy patients by using synthe...

    ID: 1772008

    Description: epitope description:VPSTPPTPSPSTPPTPSPS antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 14996305;
  50. Thymic expression of a gastritogenic epitope results in positive selection of self-reactive pathogenic T cells.

    ID: 1772010

    Description: epitope description:LLNVPKNMQVSIVCKILADHVTFNN antigen name:Potassium-transporting ATPase subunit beta host organism:Oryctolagus cuniculus

    Publication: 15128782;

Displaying 50 of 1,510,353 results for " "