Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

ID: 1383758

Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Mus musculus antibody name:F376

Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

ID: 1383762

Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

ID: 1383885

Description: epitope description:MQWNSTAFHQTLQDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

Characterization and sequence analyses of antibody-selected antigenic variants of herpes simplex virus show a conformationally complex epitope on glyc...

ID: 1384067

Description: epitope description:D168 antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:LP11

RIVETS: the recombinant immunoglobulin and viral epitope tag system.

ID: 1384069

Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:8F9