Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491429

    Description: epitope description:GSSNPTILSEGN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  2. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491434

    Description: epitope description:GNSFTAPNESYK antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  3. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491446

    Description: epitope description:SSCSNWVWQSTQ antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  4. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491451

    Description: epitope description:TQDVFYNGAYFV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  5. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491452

    Description: epitope description:DVFYNGAYFVSS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  6. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491456

    Description: epitope description:FVSSGKYEGGNI antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  7. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491461

    Description: epitope description:NIYTKKEAFNVE antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  8. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491463

    Description: epitope description:KKEAFNVENGNA antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  9. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491466

    Description: epitope description:VENGNATPQLTK antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  10. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491471

    Description: epitope description:TKNAGVLTCSLS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  11. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491472

    Description: epitope description:NAGVLTCSLSKR antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  12. Structure-immunogenicity relationship of melittin, its transposed analogues, and D-melittin.

    ID: 1491488

    Description: epitope description:GIGAVLKVLTTGLPALISWIKRKRQQ antigen name:Api m 4 host organism:Mus musculus BALB/c

    Publication: 8027544;

  13. Identification of binding sites for neutralizing monoclonal antibodies on the 14-kDa fusion protein of orthopox viruses.

    ID: 1491541

    Description: epitope description:STKAAKKPEAKREAI antigen name:Protein A27 host organism:Mus musculus BALB/c antibody name:3F5

    Publication: 7513923;

  14. Candidate multi-peptide-vaccine against classical swine fever virus induced potent immunity with serological marker.

    ID: 1491553

    Description: epitope description:CKEDYRYAISSTNEIGLLGAGGLT antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 15882522;

  15. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491566

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  16. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491569

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  17. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491570

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Oryctolagus cuniculus

    Publication: 15100313;

  18. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491575

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  19. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491577

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;

  20. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491589

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;

  21. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491607

    Description: epitope description:CGAVIDDC host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 15049781;

  22. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491630

    Description: epitope description:EMPKNYEKVSLNRKK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 16517887;

  23. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491631

    Description: epitope description:DMPQSYIQNQEKYKK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 16517887;

  24. Passive protection against lethal enterovirus 71 infection in newborn mice by neutralizing antibodies elicited by a synthetic peptide.

    ID: 1491641

    Description: epitope description:VSSHRLDTGEVPALQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17890123;

  25. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491646

    Description: epitope description:KVRAYTYGVVDMPQSYIQNQEKYKK antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 16517887;

  26. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491651

    Description: epitope description:KVRAYTYGVVEMPTSYMESQKRKKK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 16517887;

  27. Structure-immunogenicity relationship of melittin and its N-terminal truncated analogs.

    ID: 1491662

    Description: epitope description:TTGLPALISWIKRKRQQ antigen name:Api m 4 host organism:Mus musculus BALB/c

    Publication: 7681691;

  28. Bioinformatics and multiepitope DNA immunization to design rational snake antivenom.

    ID: 1491728

    Description: epitope description:TECRGIRSECDLPEYCTGQ antigen name:Group III snake venom metalloproteinase (UniProt:Q2UXQ2) host organism:Mus musculus BALB/c

    Publication: 16737347;

  29. Bioinformatics and multiepitope DNA immunization to design rational snake antivenom.

    ID: 1491735

    Description: epitope description:GTKCEDGKVC antigen name:Group III snake venom metalloproteinase (UniProt:Q2UXQ2) host organism:Mus musculus BALB/c

    Publication: 16737347;

  30. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491765

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Hyperimmune sera

    Publication: 15295710;

  31. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491772

    Description: epitope description:PEHKKEENMLSHLYVSSKDKENISKEND antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Human sera

    Publication: 15295710;

  32. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491777

    Description: epitope description:YEKAKNAYQKANQAVLKAKEASSYD antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Hyperimmune sera

    Publication: 15295710;

  33. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491780

    Description: epitope description:PEHKKEENMLSHLYVSSKDKENISKEND antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Hyperimmune sera

    Publication: 15295710;

  34. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491783

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Affinity purified se...

    Publication: 15295710;

  35. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491784

    Description: epitope description:MLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKN antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Affin...

    Publication: 15295710;

  36. Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

    ID: 1491833

    Description: epitope description:CSKPKNRTC host organism:Mus musculus BALB/c antibody name:F4

    Publication: 10075827;

  37. Immunological analysis of the protective responses to the chimeric synthetic peptide representing T- and B-cell epitopes from the fusion protein of me...

    ID: 1479671

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 8806185;

  38. Induction of neutralizing antibodies by synthetic peptides representing the C terminus of coxsackievirus A9 capsid protein VP1.

    ID: 1479728

    Description: epitope description:EAIPALTAVETGHTSQV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9747735;

  39. Induction of neutralizing antibodies by synthetic peptides representing the C terminus of coxsackievirus A9 capsid protein VP1.

    ID: 1479730

    Description: epitope description:EAIPALTAVETGHTSQV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9747735;

  40. Characterisation of a protective linear B cell epitope against feline parvoviruses.

    ID: 1479737

    Description: epitope description:DGAVQPDGGQPAVRNERA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11257360;

  41. Mapping antigenic sites of an immunodominant surface lipoprotein of Mycoplasma agalactiae, AvgC, with the use of synthetic peptides.

    ID: 1479746

    Description: epitope description:DKKDKEDK antigen name:Variable surface lipoprotein U (VpmaUprecursor) host organism:Ovis aries

    Publication: 11748179;

  42. Coimmunization with complementary glucosyltransferase peptides results in enhanced immunogenicity and protection against dental caries.

    ID: 1479754

    Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:UniProt:I6TY13 host organism:Rattus norvegicus

    Publication: 10768962;

  43. Epitope mapping of the Pseudomonas aeruginosa major outer membrane porin protein OprF.

    ID: 1479756

    Description: epitope description:NLADFMKQ antigen name:Outer membrane porin F host organism:Mus musculus antibody name:MA7-2

    Publication: 7806382;

  44. Epitope mapping of the Pseudomonas aeruginosa major outer membrane porin protein OprF.

    ID: 1479757

    Description: epitope description:TAEGRAIN antigen name:Outer membrane porin F host organism:Mus musculus antibody name:MA5-8

    Publication: 7806382;

  45. Papaya ringspot virus coat protein gene for antigen presentation in Escherichia coli.

    ID: 1479765

    Description: epitope description:VQPDGGQPAVRNERA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c

    Publication: 16466633;

  46. The reactivity of naturally sensitized human CD4 cells and IgG antibodies to synthetic peptides derived from the amino terminal sequences of a 3800 MW...

    ID: 1479773

    Description: epitope description:GAGAGAVDSILGGVATYGAAC host organism:Homo sapiens antibody name:human serum

    Publication: 1689692;

  47. Monoclonal antibody against species-specific epitope of Pseudomonas aeruginosa Hsp60 protein cross-reacts with Pseudomonas stutzeri and other Pseudomo...

    ID: 1479958

    Description: epitope description:QADIEARVLQ antigen name:60 kDa chaperonin host organism:Mus musculus antibody name:2528

    Publication: 9297831;

  48. Precise characterization of the epitope recognized by a monoclonal antibody against Escherichia coli RNA polymerase.

    ID: 1479963

    Description: epitope description:VDGSDP antigen name:DNA-directed RNA polymerase subunit beta' (UniProt:P0A8T7) host organism:Mus musculus antibody name:11D11

    Publication: 15785203;

  49. Streptococcus pneumoniae enolase is important for plasminogen binding despite low abundance of enolase protein on the bacterial cell surface.

    ID: 1479971

    Description: epitope description:DKSRYGGLG antigen name:Enolase host organism:Mus musculus BALB/c antibody name:245, C-6

    Publication: 16622048;

  50. Structural variation and immune recognition of the P1.2 subtype meningococcal antigen.

    ID: 1479974

    Description: epitope description:HFVQQTPKSQPTLV antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN16C13F4

    Publication: 16470851;

  51. Induction of neutralizing antibodies by synthetic peptides representing the C terminus of coxsackievirus A9 capsid protein VP1.

    ID: 1479983

    Description: epitope description:QSRRRGDMST antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9747735;

  52. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479986

    Description: epitope description:Q249 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:B69

    Publication: 8178574;

  53. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479987

    Description: epitope description:E321 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:57

    Publication: 8178574;

  54. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479989

    Description: epitope description:E311, Q320 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:179

    Publication: 8178574;

  55. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479993

    Description: epitope description:E311, Q320 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:179

    Publication: 8178574;

  56. Prediction and identification of a T cell epitope in the fusion protein of measles virus immunodominant in mice and humans.

    ID: 1480016

    Description: epitope description:LSEIKGVIVHRLEGV antigen name:Fusion glycoprotein F0 host organism:Mus musculus Swiss

    Publication: 2212993;

  57. Prediction and identification of a T cell epitope in the fusion protein of measles virus immunodominant in mice and humans.

    ID: 1480017

    Description: epitope description:LSEIKGVIVHRLEGV antigen name:Fusion glycoprotein F0 host organism:Mus musculus SJL

    Publication: 2212993;

  58. Prediction and identification of a T cell epitope in the fusion protein of measles virus immunodominant in mice and humans.

    ID: 1480020

    Description: epitope description:LSEIKGVIVHRLEGV antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 2212993;

  59. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480034

    Description: epitope description:LTGISICNPGSSLC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  60. Characterization of a monoclonal antibody recognizing a DAG-containing epitope conserved in aphid transmissible potyviruses: evidence that the DAG mot...

    ID: 1480038

    Description: epitope description:CSDTIDAGKD antibody name:6C2-2C7

    Publication: 9879757;

  61. Antiviral effect on MS-2 coliphage obtained with a synthetic antigen.

    ID: 1480053

    Description: epitope description:QGLLKDGNPIPSAIAANSGIY antigen name:Coat protein host organism:Oryctolagus cuniculus albino antibody name:anti-P3

    Publication: 63950;

  62. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480063

    Description: epitope description:CAVFVRSGQPVIGA antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  63. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480064

    Description: epitope description:VSKEEQYYDYEDAT antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  64. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480065

    Description: epitope description:LTGISICNPGSSLC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  65. The use of synthetic peptides can be a misleading approach to generate vaccines against scorpion toxins.

    ID: 1480073

    Description: epitope description:KEGYLVDKNTGCKYECLKLGDNDYCLR antigen name:Beta-mammal toxin Cn2 host organism:Mus musculus CD1

    Publication: 8578804;

  66. The use of synthetic peptides can be a misleading approach to generate vaccines against scorpion toxins.

    ID: 1480081

    Description: epitope description:KQQGYKGAGGY antigen name:Beta-mammal toxin Cn2 host organism:Mus musculus CD1

    Publication: 8578804;

  67. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480086

    Description: epitope description:GEYGGVIKDGTPGGA antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  68. The use of synthetic peptides can be a misleading approach to generate vaccines against scorpion toxins.

    ID: 1480090

    Description: epitope description:KGYLVDKNTGCKY host organism:Mus musculus CD1

    Publication: 8578804;

  69. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480096

    Description: epitope description:LTGISICNPGSSLC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  70. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480097

    Description: epitope description:TRNTGQPATDHYYSNV antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  71. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480098

    Description: epitope description:LPAYQDYTARAQVSE antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(21-35)

    Publication: 3919385;

  72. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480105

    Description: epitope description:EGQKSAVTEY antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(41-50)

    Publication: 3919385;

  73. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480106

    Description: epitope description:TEYYLNHGKWPEN antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(48-60)

    Publication: 3919385;

  74. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480117

    Description: epitope description:SLWARRENGSVKWFC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(107-121)

    Publication: 3919385;

  75. Antibody to glucosyltransferase induced by synthetic peptides associated with catalytic regions of alpha-amylases.

    ID: 1480131

    Description: epitope description:VPSYSFIRAHDSEVQDLIA antigen name:UniProt:I6TY13 host organism:Rattus norvegicus Sprague-Dawley

    Publication: 10225934;

  76. Identification of a human immunodominant B-cell epitope within the immunoglobulin A1 protease of Streptococcus pneumoniae.

    ID: 1480137

    Description: epitope description:IQPELPEAVVSDKGEPEVQPTLPEAVVTDKGETEVQPE antigen name:Immunoglobulin A1 protease host organism:Homo sapiens

    Publication: 18088426;

  77. Epitope mapping on N-terminal region of taenia solium paramyosin.

    ID: 1480154

    Description: epitope description:FRTAISGTPQFY host organism:Oryctolagus cuniculus

    Publication: 10880841;

  78. Peptide/antibody recognition: synthetic peptides derived from the E. coli tryptophan synthase beta 2 subunit interact with high affinity with an anti-...

    ID: 1480184

    Description: epitope description:HGRVGIYFGMK antigen name:Tryptophan synthase beta chain host organism:Mus musculus antibody name:164-2

    Publication: 2062325;

  79. Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conju...

    ID: 1480185

    Description: epitope description:TKDTNNNL + ACET(T1) antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN12H2

    Publication: 9294871;

  80. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480234

    Description: epitope description:TRLENLMWK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17329445;

  81. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480246

    Description: epitope description:VVSWKNKEL antigen name:Genome polyprotein host organism:Mus musculus Outbred

    Publication: 17329445;

  82. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480259

    Description: epitope description:LENLMWKQI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17329445;

  83. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480262

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4

    Publication: 17329445;

  84. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480266

    Description: epitope description:ELRYSWKTWGKAKMLSTELH antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A12.3, 3D1.4, 4H3.4, 3A5.4, ...

    Publication: 17329445;

  85. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480267

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3

    Publication: 17329445;

  86. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480305

    Description: epitope description:ELRYSWKTWGKAKMLSTELH antigen name:Genome polyprotein host organism:Mus musculus antibody name:anti-AFLX1

    Publication: 17329445;

  87. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480306

    Description: epitope description:ELRYSWKTWGKAKMLSTELH antigen name:Genome polyprotein host organism:Mus musculus antibody name:anti-D-2V NS1

    Publication: 17329445;

  88. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480336

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 17329445;

  89. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480341

    Description: epitope description:GKAKMLSTE antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 17329445;

  90. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480361

    Description: epitope description:YSWKTWGKA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A12.3

    Publication: 17329445;

  91. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480368

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3

    Publication: 17329445;

  92. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480373

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4

    Publication: 17329445;

  93. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480375

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3A5.4

    Publication: 17329445;

  94. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480401

    Description: epitope description:YFYDNTVGLNGIPTL antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:DD1

    Publication: 11254559;

  95. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480402

    Description: epitope description:DFAGVYGKTLSDYWSKYYDKFKLLLKNYYI antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:BF8

    Publication: 11254559;

  96. Conformational epitopes recognized by protective anti-neisserial surface protein A antibodies.

    ID: 1480409

    Description: epitope description:D113, L114, G115, G116, S117 antigen name:Outer membrane protein NspA host organism:Mus musculus CD1 antibody name:14C7, AL12

    Publication: 14638771;

  97. Immunoglobulin G antibodies binding to a synthetic peptide deduced from the nucleotide sequence of the env gene of HTLV I in patients with leukemia an...

    ID: 1480417

    Description: epitope description:TNSHVPILQERPPLE antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2999520;

  98. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487714

    Description: epitope description:QWIFGMS host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  99. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487716

    Description: epitope description:TASTLHKTLFGM host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  100. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487743

    Description: epitope description:DWERPTPYELSI host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston