Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474360

    Description: epitope description:IMSALAMVYLGAK antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  2. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474364

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  3. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474365

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 7950407;

  4. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474366

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 7950407;

  5. Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

    ID: 1474391

    Description: epitope description:VYNGNCKYGENAVTNVRGDLQVLAQKAARCLPTSFNYGAIK host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera

    Publication: 12057619;

  6. A virosomal malaria peptide vaccine elicits a long-lasting sporozoite-inhibitory antibody response in a phase 1a clinical trial.

    ID: 1474411

    Description: epitope description:NPNANPNANPNANPNENPNA host organism:Homo sapiens antibody name:Human sera

    Publication: 18060072;

  7. A virosomal malaria peptide vaccine elicits a long-lasting sporozoite-inhibitory antibody response in a phase 1a clinical trial.

    ID: 1474414

    Description: epitope description:NPNANPNANPNANPNENPNA host organism:Homo sapiens antibody name:Human sera

    Publication: 18060072;

  8. Linear IgE epitope mapping of the English walnut (Juglans regia) major food allergen, Jug r 1.

    ID: 1474451

    Description: epitope description:QGLRGEEMEEMV antigen name:Jug r 1 host organism:Homo sapiens antibody name:affinity-purified patient serum

    Publication: 11799381;

  9. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474453

    Description: epitope description:QLVKDKNIDISIKYDPRKDSE antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  10. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474455

    Description: epitope description:DNQLQNGIKRVKEFL antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  11. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474456

    Description: epitope description:ESSPNTQWELRAFMA antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  12. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474461

    Description: epitope description:LTAELKIYSVIQAEINKHL antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  13. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474466

    Description: epitope description:DNQLQNGIKRVKEFL antigen name:Virulence-associated V antigen host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 18096277;

  14. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474474

    Description: epitope description:TTCSDKSRPLNDLVS antigen name:Virulence-associated V antigen host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 18096277;

  15. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474487

    Description: epitope description:QLVKDKNIDISIKYDPRKDSE antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  16. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474492

    Description: epitope description:GSENKRTGALGNLKN antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  17. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474508

    Description: epitope description:ISIKYDPRKDSEVFA antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  18. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474511

    Description: epitope description:LTAELKIYSVIQAEINKHL antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  19. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474529

    Description: epitope description:DIELLKKILAGGFIQKYDSVMQ host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  20. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474532

    Description: epitope description:EYKILEKMPQTTIQVDGSEKKI antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston