Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480368

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3

    Publication: 17329445;

  2. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480373

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4

    Publication: 17329445;

  3. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480375

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3A5.4

    Publication: 17329445;

  4. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480401

    Description: epitope description:YFYDNTVGLNGIPTL antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:DD1

    Publication: 11254559;

  5. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480402

    Description: epitope description:DFAGVYGKTLSDYWSKYYDKFKLLLKNYYI antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:BF8

    Publication: 11254559;

  6. Conformational epitopes recognized by protective anti-neisserial surface protein A antibodies.

    ID: 1480409

    Description: epitope description:D113, L114, G115, G116, S117 antigen name:Outer membrane protein NspA host organism:Mus musculus CD1 antibody name:14C7, AL12

    Publication: 14638771;

  7. Immunoglobulin G antibodies binding to a synthetic peptide deduced from the nucleotide sequence of the env gene of HTLV I in patients with leukemia an...

    ID: 1480417

    Description: epitope description:TNSHVPILQERPPLE antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2999520;

  8. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487714

    Description: epitope description:QWIFGMS host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  9. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487716

    Description: epitope description:TASTLHKTLFGM host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  10. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487743

    Description: epitope description:DWERPTPYELSI host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston