Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384331

    Description: epitope description:QHDVNFTQEVSRLNINLHFSKCGFPF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  2. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384333

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  3. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384337

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  4. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384338

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  5. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384352

    Description: epitope description:CRFPNITNSHVPILQERPPLENRVLTGYGL host organism:Homo sapiens

    Publication: 1955565;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston