Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

ID: 1384360

Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

ID: 1384383

Description: epitope description:STTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

ID: 1384391

Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

ID: 1384394

Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

Monoclonal antibody against non-dominant epitopes of HBV e Ag was raised by antigen-antibody co-immunization.

ID: 1384396

Description: epitope description:LVSFGVWIRTPPAYRPPN antigen name:External core antigen host organism:Mus musculus antibody name:EWB