Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770274

    Description: epitope description:SASASLG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  2. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770279

    Description: epitope description:LGASVKV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  3. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770280

    Description: epitope description:GASVKVT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  4. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770281

    Description: epitope description:ASVKVTC antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  5. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770285

    Description: epitope description:VTCTLSR antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  6. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770295

    Description: epitope description:SYAIAWH antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  7. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770302

    Description: epitope description:QQQPERG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  8. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770303

    Description: epitope description:QQPERGL antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  9. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770316

    Description: epitope description:NSDGSHT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  10. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770322

    Description: epitope description:TRGDAIP antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  11. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770331

    Description: epitope description:FSGSSSG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  12. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770332

    Description: epitope description:SGSSSGT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  13. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770335

    Description: epitope description:SSGTERI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  14. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770343

    Description: epitope description:TISSLQS antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  15. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770345

    Description: epitope description:SSLQSED antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  16. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770349

    Description: epitope description:SEDEADY antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  17. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770350

    Description: epitope description:EDEADYY antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  18. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770351

    Description: epitope description:DEADYYC antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  19. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770353

    Description: epitope description:ADYYCQT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  20. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770355

    Description: epitope description:YYCQTWG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  21. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770369

    Description: epitope description:EGSTDVDEPLEVFISAPRSE antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  22. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770370

    Description: epitope description:SNSKVECQAQARTHH antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  23. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770374

    Description: epitope description:THHNQASDIIVISS antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  24. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770376

    Description: epitope description:SDIIVISSEDSEGST antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  25. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770384

    Description: epitope description:YLSLTPE antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  26. Localization of the binding regions of a murine monoclonal anti-factor VIII antibody and a human anti-factor VIII alloantibody, both of which inhibit ...

    ID: 1770388

    Description: epitope description:TDSEMDVVRFDDDNS antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 2839543;

  27. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770394

    Description: epitope description:PDRFSGS antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  28. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770398

    Description: epitope description:YDSYAIA antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  29. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770403

    Description: epitope description:PDRFSGS antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  30. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770405

    Description: epitope description:YCQTWGS antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  31. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770407

    Description: epitope description:SVKVTCT antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  32. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770417

    Description: epitope description:DGSHTRG antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  33. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770430

    Description: epitope description:ATLVCLI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  34. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770435

    Description: epitope description:GASVKVT antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  35. A potent erythropoietin-mimicking human antibody interacts through a novel binding site.

    ID: 1770476

    Description: epitope description:E49, L50, W88, E121, R123, P131, H134, R135, V136, H138 antigen name:Erythropoietin receptor host organism:Mus musculus Xenomouse ...

    Publication: 17620453;

  36. Epitope localization of monoclonal antibodies against factor VIII light chain which inhibit complex formation by factor VIII with von Willebrand facto...

    ID: 1770484

    Description: epitope description:EDFDIYDEDE antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:NMC-VIII/10

    Publication: 1724391;

  37. Epitope localization of monoclonal antibodies against factor VIII light chain which inhibit complex formation by factor VIII with von Willebrand facto...

    ID: 1770485

    Description: epitope description:EDFDIYDEDE antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:NMC-VIII/8, NMC-VIII/9, NMC-VIII/10

    Publication: 1724391;

  38. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

    ID: 1770506

    Description: epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1

    Publication: 20195520;

  39. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

    ID: 1770508

    Description: epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1

    Publication: 20195520;

  40. Structural basis for the preferential recognition of immature flaviviruses by a fusion-loop antibody.

    ID: 1770520

    Description: epitope description:C74, P75, T76, M77, G78, E79, G104, C105, G106, L107, G109, K110 antigen name:Genome polyprotein host organism:Mus musculus BALB/c...

    Publication: 19713934;

  41. Targeted antipeptide antibodies to cytochrome P450 2C18 based on epitope mapping of an inhibitory monoclonal antibody to P450 2C51.

    ID: 1770521

    Description: epitope description:QESLDMNSARDF antigen name:Cytochrome P450 2C18 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9028867;

  42. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764349

    Description: epitope description:RNLTYIDPDALKELPLLKFL antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  43. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764354

    Description: epitope description:PDLTKVYSTDIFFILEITDN antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7664661;

  44. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764356

    Description: epitope description:EITDNPYMTSIPVNAFQGLC antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  45. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764360

    Description: epitope description:FQGLCNETLTLKLYNNGFTS antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7664661;

  46. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764361

    Description: epitope description:FQGLCNETLTLKLYNNGFTS antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  47. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764367

    Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  48. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764371

    Description: epitope description:DVSQTSVTALPSKGLEHLKE antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  49. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764378

    Description: epitope description:KLPLSLSFLHLTRADLSYPS antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7664661;

  50. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764382

    Description: epitope description:LSYPSHCCAFKNQKKIRGIL antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston