Exploring the basis of peptide-carbohydrate crossreactivity: evidence for discrimination by peptides between closely related anti-carbohydrate antibod...

ID: 1244629

Description: epitope description:MDWNMH host organism:Mus musculus antibody name:SYA/J6

Expression of the nucleoprotein of rabies virus in Escherichia coli and mapping of antigenic sites.

ID: 1244630

Description: epitope description:FFRDEKEL antigen name:Nucleoprotein host organism:Mus musculus antibody name:6-4, 13-27, 12-2

Identifying the principal protective antigenic determinants of type A botulinum neurotoxin.

ID: 1244634

Description: epitope description:GTKFIIKKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody nam...

Toward a better understanding of the basis of the molecular mimicry of polysaccharide antigens by peptides: the example of Shigella flexneri 5a.

ID: 1244652

Description: epitope description:beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-[alpha-D-Glcp-(1->3)]-alpha-L-Rhap-(1->3)-alpha-L-Rhap antigen name:lipopolysaccharide h...

Toward a better understanding of the basis of the molecular mimicry of polysaccharide antigens by peptides: the example of Shigella flexneri 5a.

ID: 1244666

Description: epitope description:KRHFLSQRQ host organism:Mus musculus antibody name:C5, I3

Mapping of B epitopes in GRA4, a dense granule antigen of Toxoplasma gondii and protection studies using recombinant proteins administered by the oral...

ID: 1244675

Description: epitope description:KGFGGTRTSTAPAEAGKTELDDGYRPPPFNPRPSPYAELLKDLERMRKE antigen name:Other Toxoplasma gondii protein host organism:Homo sapiens

Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

ID: 1245767

Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe...

Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

ID: 1245831

Description: epitope description:SPRWYFYYLGTGPEASLPYG antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

ID: 1245835

Description: epitope description:NPNNNAATVLQLPQGTTLPK antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

ID: 1245840

Description: epitope description:DRLNQLESKVSGKGQQQQGQ antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

ID: 1245843

Description: epitope description:VTQAFGRRGPEQTQGNFGDQ antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

New methods using polyvinylidene difluoride membranes to detect enzymes involved in glycosphingolipid metabolism.

ID: 1245881

Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-Galp antigen name:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc host organism...

Development of a plant-derived subunit vaccine candidate against hepatitis C virus.

ID: 1245888

Description: epitope description:QTTVVGGSQSHTVRGLTSLFSPGASQN host organism:Homo sapiens

Development of a plant-derived subunit vaccine candidate against hepatitis C virus.

ID: 1245900

Description: epitope description:QTTVVGGSQSHTVRGLTSLFSPGASQN host organism:Mus musculus C57BL/6

Vaccination with the recombinant Brucella outer membrane protein 31 or a derived 27-amino-acid synthetic peptide elicits a CD4+ T helper 1 response th...

ID: 1246085

Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c

Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

ID: 1246102

Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe...

Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

ID: 1246116

Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp-(1...

Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

ID: 1246118

Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp-(1...

Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

ID: 1246142

Description: epitope description:G406, A440, D442 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5H6

Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

ID: 1246143

Description: epitope description:S514, S516 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5A12