Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Mapping of the mAb73 epitope on Ad2 E1A proteins with random peptide libraries and deletion mutants.

    ID: 1488009

    Description: epitope description:AHIRHHKMPVTTSAT host organism:Mus musculus BALB/c antibody name:mAb73

    Publication: 7507452;

  2. Monoclonal antibodies, against O1 serotype foot-and-mouth disease virus, from a natural bovine host, recognize similar antigenic features to those def...

    ID: 1488025

    Description: epitope description:N770 antigen name:Polyprotein host organism:Bos taurus Friesian antibody name:MH5

    Publication: 9680132;

  3. Epitope mapping of anti-recA protein IgGs by region specified polymerase chain reaction mutagenesis.

    ID: 1488045

    Description: epitope description:TAKEIEKKVRELLLSNPNSTPDFS antigen name:Protein RecA host organism:Mus musculus BALB/c antibody name:ARM193

    Publication: 1372903;

  4. Identification of immunodominant neutralizing epitopes on the hemagglutinin protein of rinderpest virus.

    ID: 1488142

    Description: epitope description:DSGTRK antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:mAb 59

    Publication: 11799164;

  5. Identification of immunodominant neutralizing epitopes on the hemagglutinin protein of rinderpest virus.

    ID: 1488173

    Description: epitope description:REACR antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:mAb 39

    Publication: 11799164;

  6. Phage-displayed Bet mim 1, a mimotope of the major birch pollen allergen Bet v 1, induces B cell responses to the natural antigen using bystander T ce...

    ID: 1488213

    Description: epitope description:CFPYCYPSESA host organism:Mus musculus BALB/c

    Publication: 12569978;

  7. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1488238

    Description: epitope description:TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN antigen name:Potassium channel toxin alpha-KTx 2.1 host organism:Mus musculus BALB/c antib...

    Publication: 11750040;

  8. Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and de...

    ID: 1488268

    Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Mus musculus BALB/c antibody name:FdR-1a, FdR-1b, FdR-2b, C...

    Publication: 7687098;

  9. Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and de...

    ID: 1488270

    Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Mus musculus BALB/c antibody name:FdR-1a, C5/24.6

    Publication: 7687098;

  10. Binding of monoclonal antibody 4B1 to homologs of the lactose permease of Escherichia coli.

    ID: 1488306

    Description: epitope description:F247, F250, G254 antigen name:Lactose permease host organism:Mus musculus BALB/c antibody name:4B1

    Publication: 9232651;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston