Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246144

    Description: epitope description:K549 antigen name:Structural polyprotein host organism:Mus musculus antibody name:3E11

    Publication: 8973533;

  2. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246154

    Description: epitope description:S532, S533 antigen name:Structural polyprotein host organism:Mus musculus antibody name:2D4

    Publication: 8973533;

  3. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246342

    Description: epitope description:QVSIQDTRNAVRACRIQYHHDPQPVGREKFTIRPHYGK antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 2473217;

  4. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246395

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  5. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246396

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  6. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246411

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  7. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246413

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  8. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246415

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  9. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246426

    Description: epitope description:RTTTASGKLIT + NAc(R1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H5.4, 1G5.3

    Publication: 7944953;

  10. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246445

    Description: epitope description:LRYSWKTWGKA + NAc(L1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4, 1A12.3

    Publication: 7944953;

  11. Use of recombinant fusion proteins and monoclonal antibodies to define linear and discontinuous antigenic sites on the dengue virus envelope glycoprot...

    ID: 1246594

    Description: epitope description:NKPTLDFELI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:E2A10

    Publication: 1372140;

  12. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267403

    Description: epitope description:ATFQVE antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  13. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267404

    Description: epitope description:TFQVEV antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  14. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267405

    Description: epitope description:FQVEVP antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  15. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267408

    Description: epitope description:HIDSQK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  16. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267417

    Description: epitope description:TPQNIT antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  17. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267431

    Description: epitope description:QIHTLN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  18. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267433

    Description: epitope description:HTLNNK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  19. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267437

    Description: epitope description:NKIFSY antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  20. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267446

    Description: epitope description:AGKREM antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston