Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Isolation and structure-functional characterization of phage display library-derived mimotopes of noxiustoxin, a neurotoxin of the scorpion Centruroid...

    ID: 1488349

    Description: epitope description:HNNQRLMLYGMH host organism:Mus musculus BALB/c antibody name:BNTX18

    Publication: 11275260;

  2. Isolation and structure-functional characterization of phage display library-derived mimotopes of noxiustoxin, a neurotoxin of the scorpion Centruroid...

    ID: 1488355

    Description: epitope description:EALYGMS host organism:Mus musculus BALB/c antibody name:BNTX18

    Publication: 11275260;

  3. Epitopes on Cry j I and Cry j II for the human IgE antibodies cross-reactive between Cupressus sempervirens and Cryptomeria japonica pollen.

    ID: 1488395

    Description: epitope description:NAGVLTCSLSK antigen name:Cry j 1 host organism:Mus musculus BALB/c antibody name:027

    Publication: 7679186;

  4. Immunodominant sites of human T cell lymphotropic virus type 1 envelope protein for murine helper T cells.

    ID: 1488454

    Description: epitope description:LPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus B10.BR

    Publication: 2528586;

  5. Immunodominant sites of human T cell lymphotropic virus type 1 envelope protein for murine helper T cells.

    ID: 1488456

    Description: epitope description:FTQEVSRLNINLHFSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus B10.BR

    Publication: 2528586;

  6. Epitope determinants of a chimpanzee dengue virus type 4 (DENV-4)-neutralizing antibody and protection against DENV-4 challenge in mice and rhesus mon...

    ID: 1488475

    Description: epitope description:K174, P176 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:Fab 5H2

    Publication: 17881450;

  7. Characterization of IgE-binding epitopes on Candida albicans enolase.

    ID: 1488480

    Description: epitope description:QAANDSYAAGWGVMVSHRSGETEDTFIADLSVGLRSGQI antigen name:Enolase 1 host organism:Homo sapiens

    Publication: 7544233;

  8. Epitope determinants of a chimpanzee dengue virus type 4 (DENV-4)-neutralizing antibody and protection against DENV-4 challenge in mice and rhesus mon...

    ID: 1488482

    Description: epitope description:K174, P176 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 17881450;

  9. Identification of an IgE-binding determinant of the major allergen Myr p I from the venom of the Australian jumper ant Myrmecia pilosula.

    ID: 1488608

    Description: epitope description:KEAIPMAVEMAKSQ antigen name:Myr p 1 host organism:Homo sapiens

    Publication: 7508264;

  10. Subgroup specific protection of mice from respiratory syncytial virus infection with peptides encompassing the amino acid region 174-187 from the G gl...

    ID: 1488614

    Description: epitope description:VPCSICSNNPTCWAICK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 9141214;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston