Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774925

    Description: epitope description:LRDSYTQVCDPRLMS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  2. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774927

    Description: epitope description:PRLMSAAIKDSKAVH antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  3. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774934

    Description: epitope description:WIESEKNETWKLARA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  4. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774937

    Description: epitope description:WIESEKNETWKLARA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  5. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774939

    Description: epitope description:KLARASFIEVKTCVW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  6. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774945

    Description: epitope description:KTCVWPKSHTLWSNG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  7. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774946

    Description: epitope description:LWSNGVLESEMIIPK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  8. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774953

    Description: epitope description:MIIPKIYGGPISQHN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  9. Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

    ID: 1774957

    Description: epitope description:ISQHNYRPGYSTQTA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20079511;

  10. Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

    ID: 1778643

    Description: epitope description:AEPFYSWDRASR host organism:Mus musculus BALB/c antibody name:HC-10

    Publication: 12902494;

  11. Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

    ID: 1778648

    Description: epitope description:QEGPEYWDRNT antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Mus musculus BALB/c antibody name:H...

    Publication: 12902494;

  12. Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

    ID: 1778649

    Description: epitope description:EGPEYWDRET antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c antibody name:H...

    Publication: 12902494;

  13. Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

    ID: 1778650

    Description: epitope description:EGPEYWDRET antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c antibody name:H...

    Publication: 12902494;

  14. Assay for measurement of intact B-type natriuretic peptide prohormone in blood.

    ID: 1778654

    Description: epitope description:PRSPKM antigen name:Natriuretic peptides B host organism:Mus musculus BALB/c antibody name:Hinge76

    Publication: 16574763;

  15. Epitope specificity of anti-heat shock protein 65/60 serum antibodies in atherosclerosis.

    ID: 1778682

    Description: epitope description:ITVEESNT antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

    Publication: 9102173;

  16. Epitope specificity of anti-heat shock protein 65/60 serum antibodies in atherosclerosis.

    ID: 1778684

    Description: epitope description:VEESNTFG antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

    Publication: 9102173;

  17. The intracellular and extracellular domains of BP180 antigen comprise novel epitopes targeted by pemphigoid gestationis autoantibodies.

    ID: 1778695

    Description: epitope description:NSSPEYPRKEFASSSTRGRS antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 17068480;

  18. The intracellular and extracellular domains of BP180 antigen comprise novel epitopes targeted by pemphigoid gestationis autoantibodies.

    ID: 1778698

    Description: epitope description:LTWLLLLGLLFGLIALAEEVRKLKARVDELERIR antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 17068480;

  19. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1778711

    Description: epitope description:YYYNETKLKESYKVKD host organism:Mus musculus C57BL/6

    Publication: 19962461;

  20. The intracellular and extracellular domains of BP180 antigen comprise novel epitopes targeted by pemphigoid gestationis autoantibodies.

    ID: 1778721

    Description: epitope description:GPVTTITGETFDYSELASHVVSYLRTSG antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 17068480;

  21. Characterization of FMRF amide-like immunoreactivity in rat spinal cord by region-specific antibodies in radioimmunoassay and HPLC.

    ID: 1778749

    Description: epitope description:YGGFMRF antigen name:Proenkephalin-A host organism:Oryctolagus cuniculus antibody name:S253

    Publication: 2582088;

  22. Characterization of FMRF amide-like immunoreactivity in rat spinal cord by region-specific antibodies in radioimmunoassay and HPLC.

    ID: 1778757

    Description: epitope description:RHRY antigen name:Pancreatic hormone host organism:Oryctolagus cuniculus antibody name:S253

    Publication: 2582088;

  23. Characterization of FMRF amide-like immunoreactivity in rat spinal cord by region-specific antibodies in radioimmunoassay and HPLC.

    ID: 1778759

    Description: epitope description:FMRF antigen name:Ambigolimax valentianus protein host organism:Oryctolagus cuniculus antibody name:S253

    Publication: 2582088;

  24. Antibody responses to mycobacterial and self heat shock protein 65 in autoimmune arthritis: epitope specificity and implication in pathogenesis.

    ID: 1778782

    Description: epitope description:MAKTIAYDEEARRGL antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Rattus norvegicus Wistar Kyoto

    Publication: 17082575;

  25. Affects of N-terminal variation in the SeM protein of Streptococcus equi on antibody and fibrinogen binding.

    ID: 1778784

    Description: epitope description:YNLLMHLSSML antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Mus musculus...

    Publication: 20005857;

  26. Antigenic structure of histone H2B.

    ID: 1778801

    Description: epitope description:PEPAKKVPAPK antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:73C3

    Publication: 2578822;

  27. Antigenic structure of histone H2B.

    ID: 1778802

    Description: epitope description:PEPAKKVPAPK antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:73C3

    Publication: 2578822;

  28. Antigenic structure of histone H2B.

    ID: 1778807

    Description: epitope description:GKKRKRSRKE antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:69B4

    Publication: 2578822;

  29. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778818

    Description: epitope description:NSSYFPGKL antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  30. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778824

    Description: epitope description:GKASTPGAAAQIQEVKE antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  31. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778826

    Description: epitope description:TSLSGIQ antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  32. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778827

    Description: epitope description:QLFDRILL antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  33. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778831

    Description: epitope description:RVKTWRMH antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  34. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778838

    Description: epitope description:RNVELQ antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  35. Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

    ID: 1778848

    Description: epitope description:AKLVTILQAHPLQQSYD antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 1281633;

  36. What a polyclonal antibody sees in von Willebrand factor.

    ID: 1778863

    Description: epitope description:LCPPGMVRHENRCVALER antigen name:von Willebrand factor host organism:Oryctolagus cuniculus

    Publication: 17614124;

  37. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778868

    Description: epitope description:SDKFPVYKYPGKGCPTLGDEGDT host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  38. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778870

    Description: epitope description:EGLYSPWWPRSLPVL host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  39. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778890

    Description: epitope description:EKVTSTWTDWQY host organism:Homo sapiens antibody name:rAb 2B4

    Publication: 17130301;

  40. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778901

    Description: epitope description:HLNSLYYDWTEP host organism:Homo sapiens antibody name:rAb 2B4

    Publication: 17130301;

  41. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778903

    Description: epitope description:HPMYPTWYSWQP host organism:Homo sapiens antibody name:rAb 2B4

    Publication: 17130301;

  42. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778906

    Description: epitope description:SHNQLLRIQALD host organism:Homo sapiens antibody name:rAb 2B4

    Publication: 17130301;

  43. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778910

    Description: epitope description:NPWYNDLSLLTA host organism:Homo sapiens antibody name:rAb 3B

    Publication: 17130301;

  44. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778912

    Description: epitope description:GPLYQMNDALLL host organism:Homo sapiens antibody name:rAb 3B

    Publication: 17130301;

  45. Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

    ID: 1778919

    Description: epitope description:QDSRRSADALLRLQAMAGISEEQGSDTDTPIVYNDRN antigen name:Nucleoprotein host organism:Homo sapiens antibody name:rAb 2B4

    Publication: 17130301;

  46. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778924

    Description: epitope description:MCPEMSFVAVHSCAR host organism:Mus musculus antibody name:12E4

    Publication: 11468163;

  47. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778927

    Description: epitope description:KPGEMRGAA host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  48. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778935

    Description: epitope description:CNKPGERTC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  49. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778937

    Description: epitope description:CADQKPGEC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  50. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778938

    Description: epitope description:CYKPGEWAC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston